(data stored in ACNUC7421 zone)

EMBL: CP001700.PE528

CP001700.PE528       Location/Qualifiers
FT   CDS_pept        624618..625493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0540"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: sen:SACE_1630 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69483"
FT                   /db_xref="GOA:C7PXD2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACU69483.1"
FT                   /translation="MLDVNRLRLLRELSHRGTIAAVAEALSFTPSAVSQQLSTLEREAG
FT                   VALLARTGRRVTLTPAGQNLVEHTESVLEHLARAEAELARVRAGLAGPVRIGSYPSAAR
FT                   TLFPAVLTLLARSHPMLEPQITELDPAEVPSALRAGDVDMALVHEYDFVPATSDPGLNS
FT                   EALFTEPLYLAAPEQGTIADHRDSSWIVSPAGTMCRSSTERACQAAGFSPRVRHEIDDF
FT                   ATAMVLAALGQGVTLVPHLAALAPPEGLTLTRQSMSRRTRIAYRAGTAGHPAVAAVTSA
FT                   LREAVPTDLS"
     atgctcgatg tgaatcgcct gcgtctgctc cgcgaactgt cccatcgtgg cacgatcgcc        60
     gccgtcgccg aggccctgtc tttcacccct tcggccgtgt cccagcaact ttccacgctc       120
     gagcgggagg ccggggtcgc gctgctggcc cggaccggcc gccgcgtcac cctcaccccc       180
     gccgggcaga acctggtcga gcacaccgaa tcggtcctgg agcacctggc ccgcgccgag       240
     gccgaactcg cccgggttcg cgcagggctc gccggtcccg tacgcatcgg tagctacccg       300
     tccgcggccc gcaccttgtt cccggccgtc ctgaccctac tggcccgctc ccacccgatg       360
     ctcgagccgc agatcaccga gctcgacccg gccgaggtcc cctccgcgct gcgcgccggg       420
     gacgtcgaca tggccctggt ccacgagtac gacttcgtcc cggccacgtc cgatccaggc       480
     ctgaacagcg aggcgctgtt caccgagccg ctctacctgg ccgcgccgga gcaaggcacg       540
     atcgccgacc accgggacag ctcttggatc gtctccccgg ccggcacgat gtgccgcagc       600
     agcaccgaac gagcctgcca ggccgccggc ttcagcccgc gcgtgcgcca cgagatcgac       660
     gacttcgcca ccgccatggt gctcgccgcc ctgggccagg gcgtgacgct ggtcccgcac       720
     ctcgccgcgc tggccccgcc cgaaggcctg accctcaccc ggcagtccat gagtcggcgc       780
     acccgcatcg cctaccgcgc cggcaccgcc ggtcaccccg cggtcgccgc cgtcacctcc       840
     gccctgcgcg aagccgtccc caccgacctg agctga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page