(data stored in ACNUC7421 zone)

EMBL: CP001700.PE529

CP001700.PE529       Location/Qualifiers
FT   CDS_pept        630102..631304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0546"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   afe:Lferr_0188 aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69484"
FT                   /db_xref="GOA:C7PXD3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD3"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ACU69484.1"
FT                   /translation="MTLRTSPPHPGLAGGPVYLDYNATTPVDPRVADAMVPHLTYLFGN
FT                   PSSSHAYGAGPRTAMQRARGQVAAVIGARSEGEIVFTGSGSEADLLALRGAVLAAGGPR
FT                   PHVITQVTEHPAVLETCSALERLHGAQVTVLPVDGYGMLEPSTLAAALERPTALVSVMA
FT                   ANNETGALQPIAELAALAHARGALFHCDAAQAVGKIALDVRALGVDLLTIVGHKMYAPK
FT                   GVAALYVREGVRLEPVVYGGGQERALRSGTESVALAVALGAAAELVVEDLAHNEPARVA
FT                   ALRDELHRLLTAGWPGRVRLNGPDAARLPNTLNVSIDGVRGYEMLASVPDVAASTGSAC
FT                   HSGDHTTPSAVLTAMGFDEDRALGSVRLSLGRWSTRREVEKAARALIGHKLPNRDEAPP
FT                   R"
     atgaccctac gcacttctcc gccccatccc gggctggccg gcgggccggt ctacctggac        60
     tacaacgcca cgacccccgt tgacccacgc gtcgcggacg cgatggtgcc ccacctcacg       120
     tatctgttcg gcaatccgtc cagcagccat gcctacggcg ccgggcccag gacggcgatg       180
     cagcgggcgc gcgggcaggt tgcagccgtg atcggtgctc ggtcggaggg ggagatcgtg       240
     ttcactgggt cgggttcgga ggctgacctg ctcgcgctgc gcggtgcagt tctggccgcg       300
     gggggcccgc gcccgcatgt aataactcag gttacagaac acccggcggt tctggagacg       360
     tgcagcgcgc tcgagcgcct gcacggggcg caggtcacgg tgctgccggt cgacgggtac       420
     ggaatgctcg agccgagcac actggccgcc gccctggagc ggccgactgc tctggtatcg       480
     gtcatggccg ccaacaacga gactggcgcg ttgcaaccga tcgccgaact ggccgcgctc       540
     gcccacgcac gtggggcgtt gttccactgc gacgcggctc aagccgttgg gaagatcgcg       600
     ctcgacgtgc gtgccctggg ggtggatctc ctcaccattg tcggacacaa gatgtatgcg       660
     cctaagggtg tcgccgcgct gtacgtgagg gaaggcgtca ggttggaacc ggtcgtctac       720
     ggcggcggcc aggaacgtgc actgcgatcc ggcaccgaga gcgttgccct ggccgtggct       780
     ctcggtgccg cggccgagct tgtggtcgag gacctcgcgc ataacgagcc cgctcgtgtc       840
     gccgctctgc gcgatgagtt gcaccggctt ctgaccgccg gttggccggg ccgtgtccgc       900
     ctcaacggcc ctgacgcggc ccgcctgccg aacacgctta atgtcagcat tgacggggtc       960
     cgcgggtacg aaatgctcgc ttccgtgcct gacgttgcgg cgtccaccgg ttcggcctgc      1020
     cacagcggcg accacaccac cccatcggct gtcctgactg ccatgggctt cgacgaagac      1080
     cgtgcgttgg ggtccgtccg cctctcactg gggcgctgga gtactcggcg agaggttgag      1140
     aaggcggcgc gcgcgctaat cgggcataag ttgccaaata gggatgaagc tccgccacga      1200
     tag                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page