(data stored in ACNUC7421 zone)

EMBL: CP001700.PE53

CP001700.PE53        Location/Qualifiers
FT   CDS_pept        complement(52767..54476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0129 putative septum site determining
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69008"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69008.1"
FT                   /translation="MRDLTQHPVPGRPGRPRRPDPAPPPGRGPAPAAAPLAVTADPALA
FT                   DALLRVAAEAGVRIEIVPGPSAARHRWSAAPLVLIGVDQTGEVARAGLPHRPDVALIGR
FT                   DLDDASVWQRGSAVGAAHVLILPDCERWLAGMLAEADSPREEPGAVVAVLSGRGGAGGS
FT                   TLAAALALAGVRRGLRSTLVDLDPAGGGIDLLFGLETEPGPRWSELAQWRDGRLSGRSL
FT                   RDALPTYAAHSRHGLAAGLGLAEEGADRLPVLAWPRARPGEDDGPGWLGARPTVAEDPW
FT                   YDSGAPADPGKADPWLPQDSAPSGGDIAAGSANPLYGAGSPDIAEDLWSGGGSSRRQET
FT                   VGPRTGGGRFNADGSSAESLSRTRLIALENSDSEVSTEVDDGSRDRDRVADAARATARP
FT                   QHGLPILTYPHTRADLPLPAVAAEPVRAVLTALAQAGDLVVVDLPRSLDEAATEALALA
FT                   NVTLMLVPAEVRASAAASQLAAAVRLVSPDLRVVVRLPAPGGLEPLDITDVMGGLPLAG
FT                   VIGADRRLSAAAEHGEPPGSSARGTVSAFCRTFLDDLFGVASGRRSESRAAA"
     atgcgagacc tcacgcagca tcccgtcccc ggtcggccgg gccgcccccg caggccggac        60
     cccgctccgc cgccgggccg cggaccggcg ccggccgccg ccccgctggc cgtgaccgcc       120
     gatccggcgc tggccgacgc gctgctgcgg gtcgccgccg aggccggggt gcggatcgag       180
     atcgtgcccg gtcccagcgc cgcgcgccat cgctggtcgg ccgcgccgct ggtgctgatc       240
     ggcgtggacc agaccggcga ggtggcgcgc gccggactgc cgcaccggcc cgacgtggcg       300
     ctgatcggcc gcgacctgga cgacgcctcg gtctggcagc gcgggagcgc cgtgggcgcc       360
     gcgcacgtgc tgatcctgcc cgactgcgaa cgctggctgg ccggcatgct cgccgaggcc       420
     gacagcccgc gcgaggagcc cggagcggtg gtcgcggtcc tgtccgggcg cggcggcgcc       480
     ggcggctcga ccctggccgc cgcgctggcc ctggccgggg tgcgccgcgg cctgcgcagc       540
     accctggtgg atctggaccc cgccggcggc ggcatcgacc tgctcttcgg gttggagacc       600
     gagccgggac cgcgctggtc ggagctggcg cagtggcgcg acgggcggct gtccggccgc       660
     tcgctgcggg acgcgctgcc gacttacgcc gcgcactccc ggcacggcct ggccgccggc       720
     ctcggcctgg ccgaagaggg tgcggaccgg ctcccggtcc tggcctggcc acgggcccgg       780
     cccggcgagg acgacggacc cggttggctc ggcgcccggc ccacggtcgc tgaggacccc       840
     tggtacgaca gcggcgcgcc ggccgatccg ggaaaggcgg acccgtggct cccccaggac       900
     tccgcaccct ccggcggcga cattgccgcc ggatccgcga atcccttgta cggcgcggga       960
     tctccggaca tcgccgagga tctgtggtct ggcggcggtt cgtcgcgacg gcaggaaacc      1020
     gtcggaccgc ggaccggcgg aggccggttc aatgctgacg gctcatcagc ggaatcactt      1080
     tcccggaccc gcctgatcgc gctggaaaac tctgattcag aggtatcgac ggaagtcgac      1140
     gacggctccc gggatcgcga ccgggtcgcc gacgcggcgc gggcgacagc ccggccgcag      1200
     cacggtctgc cgattctcac ctacccgcac acccgcgccg acctaccgct gccggcggtc      1260
     gccgccgagc cggtgcgcgc cgtgctcacc gccttggccc aggccggcga tctggtcgtg      1320
     gtggacctgc cgcggtccct cgacgaggcg gcgaccgagg cgctggcgtt ggcgaacgtg      1380
     acgctcatgc tggtcccggc cgaggtccgg gcctcagcgg cggcctcgca gctggccgcg      1440
     gcggtccggc tggtctcgcc ggacctgcgg gtcgtggtgc ggctgccggc gcccggcggg      1500
     ctggaaccgc tcgacataac ggatgtcatg ggcgggctgc cgctggccgg ggtgatcggc      1560
     gccgaccgcc ggctctcggc cgccgccgag cacggcgaac cgccgggatc cagcgcccgg      1620
     ggcacggtgt ccgcgttctg ccggaccttc ctggacgacc tgttcggcgt ggcgtcggga      1680
     cggcgctccg agtcccgggc ggcagcatga                                       1710
//

If you have problems or comments...

PBIL Back to PBIL home page