(data stored in ACNUC7421 zone)

EMBL: CP001700.PE530

CP001700.PE530       Location/Qualifiers
FT   CDS_pept        631695..633119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0547"
FT                   /product="MiaB-like tRNA modifying enzyme YliG"
FT                   /note="KEGG: tfu:Tfu_0795 hypothetical protein; TIGRFAM:
FT                   MiaB-like tRNA modifying enzyme YliG; RNA modification
FT                   enzyme, MiaB family; PFAM: Protein of unknown function
FT                   UPF0004; Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69485"
FT                   /db_xref="GOA:C7PXD4"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD4"
FT                   /inference="protein motif:TFAM:TIGR01125"
FT                   /protein_id="ACU69485.1"
FT                   /translation="MAASRGTVSLVTLGCGRNEVDSEELAARLESAGWELADPDSVPGE
FT                   SDIIVVNTCGFIESAKKTSLETLVAASNAEAKVVAVGCVAERYGKRLAEALPEVDAVLS
FT                   FDDYPDISQRLDDVVRGKKHESHTPRDRRRLLPIAPVDRANNSSVVAPGHGIVRQDSEA
FT                   GLGGSIFLRKRLGGGGPLGDGVVAPLKLASGCDRRCSFCAIPSFRGAFISRTPDDIVAE
FT                   AEWLADAGVRELILVSENSTSYGKDFGDLQALEKLLPRLTSLVSRVRISYLQPAELRPT
FT                   LIEAIGGIPGVASYFDLSFQHASGPVLRRMRRFGDRERFLELLDKIRVIAPEAGMRSNF
FT                   IVGFPGETEDDYGEVERFVSEARLDAVGVFGYSDEEGTEALGLPDKVEQSQIADRVARL
FT                   TVISRKAMDDRAAERVGSEIEVIVKHPGRGWAAHQAPAVDGFVTLTGSSSEAGDVLRAR
FT                   VTGQDGANLIAEALAK"
     atggcggcta gtcgtggcac ggtatcgctc gtcacattgg gctgcggacg aaacgaagtc        60
     gattccgagg agctcgcggc tcgtctcgag tcggcagggt gggaactcgc cgatcctgac       120
     tccgtcccgg gtgagtctga catcatcgta gtcaatacct gcggcttcat agaatcggcg       180
     aagaagacgt cgctggagac gcttgtcgca gcgtccaatg ccgaagcgaa agtagtagcc       240
     gtaggctgtg tggccgagcg ctacggcaag aggcttgccg aggccctgcc ggaggtcgac       300
     gctgtactgt ccttcgacga ttatcccgac atatcacagc gcctcgacga tgtcgtgcga       360
     gggaagaagc acgagtccca cacgccgcgc gaccgccggc gtctgcttcc aattgcgccc       420
     gtggatcgtg cgaacaacag cagcgtggtg gcaccgggcc acggaatagt caggcaggac       480
     tccgaagctg gtttgggcgg ctctatcttc ctgcggaagc gactgggcgg cggaggccca       540
     ctgggtgacg gagtggttgc accgctgaag ctagcctccg gctgtgatcg tcggtgctcg       600
     ttctgcgcca taccttcgtt cagaggtgcc ttcatctcgc gcacccccga tgacatcgtt       660
     gccgaagccg aatggctcgc tgacgctggc gttcgtgaac tgattctcgt tagcgagaac       720
     tccacttcgt acggcaagga cttcggcgac ctccaagcct tagagaagct gttgccgagg       780
     ctcacatccc tggtgagtcg cgttcggatc agctaccttc agccggccga gcttcgtccc       840
     acgctcattg aagccatagg gggcatcccc ggtgtcgcgt catatttcga cttgtcgttc       900
     cagcatgcca gcggccccgt cttgcggagg atgcgccgct tcggtgatcg tgagcgtttc       960
     ctagaactgc ttgacaagat ccgcgttatc gcccccgagg ccggcatgcg atccaacttc      1020
     atcgtcggct ttccagggga gacagaggac gactacggcg aggtcgagag gtttgtctct      1080
     gaggcgaggc tcgacgcggt cggtgtcttc ggctactccg acgaggaggg caccgaagcg      1140
     ttgggactac ccgacaaggt ggagcagtct cagatcgcag atcgggtcgc caggctgacc      1200
     gtgatctcac ggaaggcgat ggacgaccgc gcggcggaga gggtcggctc cgagatcgag      1260
     gtcattgtca agcatccagg ccgaggttgg gcagcacatc aggcaccggc tgtcgacgga      1320
     ttcgtgacgc tgacggggag ctcgtcagag gccggggatg tcctgcgtgc gcgagtcacc      1380
     ggacaggacg gcgcgaacct catcgccgaa gcactcgcga aataa                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page