(data stored in ACNUC7421 zone)

EMBL: CP001700.PE531

CP001700.PE531       Location/Qualifiers
FT   CDS_pept        633147..634406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0548"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sgr:SGR_2123 major facilitator superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69486"
FT                   /db_xref="GOA:C7PXD5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69486.1"
FT                   /translation="MTAQAIVSDQRQSNYRQVFAIREFRYVFTAHSASMLGSVVTDVSL
FT                   SVLVLERTGSPFLAALTFALGFMPYAFAGTLLAGIGDRYPARLLLVTCNCVSAATVAVM
FT                   AMPFTPIWALIVLRFAASTIQPIFTSARAASLPEFLKGDRYTLGRSILRIVNQSTQIIG
FT                   YATGGLLLLVIQPRQALWIDAASFAVSAVLLRVGTVGRPARITDRKAQGTLIRESLSGA
FT                   RAVVRQPRIRALLFLWWTAPALAGIPEGLAAPYVRQIHAASVSVGLLMASAAVGTIGGE
FT                   VAIGTLVGPARRMRLVVPLASCSLLPLAVFVLRPDVIVAIALMGLTGVADAYMLGLDQW
FT                   FLEAVPDELRAQAFSIMFAGIMLTQGLTISIGGLAAEFAAPSLVIAISAAVGTVVIALV
FT                   CRSVLRTAPSPSSEESISVG"
     atgacagctc aagcaatagt gagcgatcaa cggcaatcca actatcgtca ggtattcgcg        60
     atacgcgagt ttcgatacgt cttcacggcg cactcggcat caatgctggg ctccgtggtc       120
     accgatgtct cgctatccgt cctcgtcctc gagcgtacgg gatccccgtt tctggctgcg       180
     ctgacgttcg cgttgggatt catgccctat gccttcgcag gcacgttgct cgccgggata       240
     ggagacaggt atccggcacg actgctcctt gtgacgtgca attgcgtatc cgcggcgaca       300
     gttgccgtca tggccatgcc atttacgcca atttgggcac taattgttct gagattcgcc       360
     gcctcgacaa tacagccaat cttcacgtcg gcgcgagcag cgagtcttcc tgagtttcta       420
     aaaggggacc gctatacact cggacggtcg atcctgcgaa tagtgaacca gagtacacag       480
     attatcggtt atgcaaccgg cggcctactc ctgttggtta ttcagcctcg ccaggcgcta       540
     tggatcgacg ccgcaagttt cgctgtatcg gctgtcctgc tccgtgtggg gaccgtgggt       600
     cgtccggccc gcatcaccga tcgcaaggcg caaggcacac tgatccgcga gtcgctgtcc       660
     ggcgcgcggg ccgtggtgag gcaaccacgt atcagggcac tgttgttcct atggtggacg       720
     gccccggcgc ttgccggtat acccgaaggg ctggcggcac cgtacgtgcg gcagatacac       780
     gcggcatcag tcagcgttgg cctcctcatg gcgtccgcag ctgtcggcac tatcggaggc       840
     gaggtggcga tcggcacgct ggtcggccct gcgcgccgga tgcggttggt ggttcctctg       900
     gccagctgtt cgcttcttcc tttggcggtg tttgtcctcc ggccggacgt gatcgtggcg       960
     attgccctga tggggctgac cggggtggcc gacgcataca tgctgggttt ggatcagtgg      1020
     ttcttggaag cggtgcctga cgaactgcgc gcccaggcct tcagcatcat gttcgcaggg      1080
     atcatgctca cacaggggct gaccattagc atcggcggct tggcggccga attcgccgcc      1140
     ccgagtttgg taattgcgat ctctgcagcc gtgggaacgg tcgtgatcgc ccttgtctgc      1200
     agatcggttc tccgaactgc tccttctccc tcaagcgagg agtcgataag tgtcggttga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page