(data stored in ACNUC7421 zone)

EMBL: CP001700.PE532

CP001700.PE532       Location/Qualifiers
FT   CDS_pept        634396..635424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0549"
FT                   /product="selenide, water dikinase"
FT                   /EC_number="2.7.9.3"
FT                   /note="KEGG: msm:MSMEG_1852 selenide, water dikinase;
FT                   TIGRFAM: selenide, water dikinase; PFAM: AIR synthase
FT                   related protein; AIR synthase related protein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69487"
FT                   /db_xref="GOA:C7PXD6"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD6"
FT                   /inference="protein motif:TFAM:TIGR00476"
FT                   /protein_id="ACU69487.1"
FT                   /translation="MSVDVEQPSGEVTRRLTQYAHGGGCACKIPPGELESVVAQLAAAE
FT                   PAKSPYELLVGLETGDDAAVVRLTGDTAIISTADFFTPVVDDAYDWGRIAATNALSDVY
FT                   AMGGTPVTAVNLLSWPRDVLPLELVAEVLRGCLDVTRAAGCHLAGGHSVDDPEPKYGMA
FT                   VTGVADARRLLRNDAATPGLPLTLTKPLGIGVLNSRHKATGEVFPQAVDAMTTLNADAA
FT                   TAALAAGATCATDVTGFGLLGHLYKLVRASGVTAVIDPGAVPYLEGARRAALDGFVSGG
FT                   TRRNLAWVNEHVAWGSGVDEVERLLLADAQTSGGLLIVGEVPGFPVIGELVLAGPRSLV
FT                   IG"
     gtgtcggttg acgtcgaaca gccgtccggt gaagtgaccc ggcggctgac ccagtatgcg        60
     cacggtggcg gctgtgcctg caagatcccg cctggcgagc tcgaaagcgt ggtggcgcaa       120
     ctcgccgccg cggagcccgc gaaaagtccg tacgagctgt tggtcggcct cgagaccggt       180
     gacgacgcag ccgtcgtccg tttgactggc gataccgcga tcatctctac cgcggacttc       240
     ttcactcccg tagtggacga tgcctatgac tggggtcgga tcgccgcgac gaacgcccta       300
     tccgacgtct acgccatggg tggcacgccg gttaccgcag tgaacctctt gtcctggcct       360
     cgggacgtac ttcctctgga gttagttgcc gaggttctgc ggggttgtct tgatgtgacc       420
     cgtgccgccg ggtgtcacct agcaggcggc cacagtgtgg acgaccccga gcccaagtac       480
     gggatggcgg tcactggtgt cgccgatgca cgacggctcc tgcgcaatga cgcagccacg       540
     ccgggcctgc ccctaaccct caccaagccg ctgggcatcg gagtactcaa tagccgtcac       600
     aaagcgacgg gggaggtttt cccccaggcg gtcgatgcga tgacgaccct gaatgccgat       660
     gccgcgaccg cggcgctcgc ggctggtgcg acgtgcgcga cggacgtcac cggcttcgga       720
     ctgctcggcc atctctacaa gttggtgcgg gctagcggtg tgacagcggt gatcgaccca       780
     ggcgctgtcc cgtatctcga gggcgcacgc cgggctgcgc tcgacggatt cgtcagcggc       840
     ggaaccaggc ggaatctcgc ctgggttaac gagcacgttg cctgggggag tggcgttgat       900
     gaggttgaac ggctgctact cgctgatgca cagacctctg gcggcctgct gatcgtcggc       960
     gaggtaccag ggttccccgt catcggtgag ctcgtgctgg ctggcccgcg atctcttgtc      1020
     atcggctga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page