(data stored in ACNUC7421 zone)

EMBL: CP001700.PE533

CP001700.PE533       Location/Qualifiers
FT   CDS_pept        635461..636594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0550"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: dac:Daci_4506
FT                   acyl-CoA dehydrogenase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69488"
FT                   /db_xref="GOA:C7PXD7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD7"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACU69488.1"
FT                   /translation="MMFDRELLDTIVNEVVAPAAAEVDTNAAFPREGVDALARAGVLGL
FT                   TVPKQFGGAGEGLRSAVNVIRTLSSACGSTAMVVAMHYSGTAVLASQERADVLQDIGDG
FT                   RHLTTLAFSEVGSRSHFWAPLSTAKADGDDVLLDARKSWVTSASQADSYVWSSRPMAAD
FT                   GPMSLWFVPSDTPGLSIPRAFDGMGLRGNDSSPVTADGVRVSQTSLLGDDGKGFDLAMA
FT                   AALPVFLVLNAAAGIGLMDALLAEAVKHLSATRLDHLNQSLAQQSPARLTLARMRIEAD
FT                   RTRCLLDETLSALEQERPDAQLFLLEVKAATDESAALVADLAMKVCGGAAFRKELGIER
FT                   RFRDSRAARVMAPTTDVLEDFVGRALCGLPLFDGPAA"
     atgatgttcg acagggagct tctcgacacg atagtcaacg aggtggtggc tccggctgcg        60
     gccgaggttg acacgaacgc ggcattcccc cgcgagggag tggatgcgct ggcccgggcc       120
     ggggtgttgg gcctcacggt gccgaagcag ttcggaggcg cgggtgaagg cctacgttcg       180
     gctgtgaatg tcattcggac gctgtcctcg gcgtgtggat cgaccgccat ggttgtcgcg       240
     atgcactaca gcgggacagc ggtcctcgca tcgcaggaac gtgccgatgt gcttcaggac       300
     ataggcgatg gccggcacct aaccacgttg gcgttctccg aagtcggttc gcgcagtcac       360
     ttctgggcac cgctgagcac tgcgaaggct gacggggacg acgtcctgct tgatgctagg       420
     aagagctggg tgacgtccgc cagccaagcc gacagctacg tttggtcgag ccggccgatg       480
     gcggccgatg gccctatgtc gctgtggttc gtgccctcag acacccccgg gctgtcgatt       540
     ccccgagcgt ttgacggtat gggattgcgg ggtaacgact cgtcacccgt gacggcggac       600
     ggggtcaggg tgtcccagac ttctctgctc ggcgacgatg gcaagggatt cgacttggcc       660
     atggcggcgg cattgccagt cttcctcgtg cttaatgccg cagctgggat cggattgatg       720
     gacgccctgc tcgccgaggc ggtcaagcac ctctccgcaa ctaggctcga ccacctgaac       780
     cagtcgctcg cccagcaatc gccggcgcgg ctgacgctcg cccggatgcg gatcgaggcc       840
     gaccggacac ggtgtctgct cgatgagacg ctatccgcgc tcgaacagga acgccccgac       900
     gcacagctgt ttctgttgga agtgaaggcg gccacggacg agtcggccgc gctcgtcgcg       960
     gacctcgcga tgaaggtgtg tggaggcgcc gcattccgca aggagttggg gatcgagcgg      1020
     cgcttccgcg actcgcgcgc tgcacgggtg atggccccca caactgacgt actcgaggat      1080
     ttcgtggggc gggcgctgtg cggcctcccg ctgttcgacg ggcccgccgc atga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page