(data stored in ACNUC7421 zone)

EMBL: CP001700.PE534

CP001700.PE534       Location/Qualifiers
FT   CDS_pept        636591..637448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0551"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_4507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69489"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD8"
FT                   /inference="similar to AA sequence:KEGG:Daci_4507"
FT                   /protein_id="ACU69489.1"
FT                   /translation="MSNRVLLGAVAYDSKVVTIWDGFRQWFRDRDLDFDYVLYSHYERQ
FT                   IEDLVEGHIDVAWHSPLAWVRTVRLARARSVGVRAVVMRDSDRDLVSAVLVRADSDLAS
FT                   LDDLRGRSVATGAIDSPQAHLLPLSMLREAGLRPDVDFKVSRFDVRVGLHGDHVGGERD
FT                   AAVALRSGLVDAACMLDANTLLFSREGTLPAGSVRVLAKTEPFDHCTMAVGPGADKSTV
FT                   DRFTALLLGMAYDDPTVRPLFDLEGLKQWLPARTDRYSALERAVDELGFLDAEGKLCAD
FT                   DYRP"
     atgagcaacc gggtcctgct cggcgcggtc gcctacgatt cgaaggtcgt cacgatctgg        60
     gacggtttcc gtcagtggtt ccgggaccgc gacttggact tcgattacgt cctgtactcc       120
     cactacgagc gtcagattga ggacctggtt gagggccaca tcgatgtggc gtggcattcg       180
     ccgttggcgt gggtccggac ggtgcgtctc gcgcgggcac ggtcagtcgg tgtgcgggcc       240
     gtggtgatgc gagacagtga tcgggatctg gtatcggcgg tcttggtccg agccgactcc       300
     gatctcgcgt cgctcgacga tttgcgcggt cggagtgtgg cgacgggagc gatcgactct       360
     cctcaagccc atctgctgcc gttgtcgatg ctccgggagg ccgggcttcg cccggatgtc       420
     gacttcaagg tctcgcgttt cgacgtgcgg gtcgggttgc acggcgacca cgtcggcggc       480
     gagcgcgacg cggcggtggc gctgcggtcc ggcctggtcg acgccgcatg catgttggat       540
     gccaacacgt tgctgttctc tcgggaggga acgctgccag cggggtcggt cagggtattg       600
     gcgaaaactg agcccttcga ccattgcacc atggcggtcg gtccgggtgc cgacaagtcg       660
     acggtcgacc gattcacggc gctcttactt ggcatggcgt acgacgatcc gaccgttcgg       720
     ccactgttcg acctcgaggg tctcaaacaa tggttgcccg cgcggacgga tcggtacagc       780
     gccttggaac gcgcggtgga cgagttgggt ttcctcgacg ctgaggggaa gctgtgtgct       840
     gacgattatc gaccttga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page