(data stored in ACNUC7421 zone)

EMBL: CP001700.PE535

CP001700.PE535       Location/Qualifiers
FT   CDS_pept        637426..638598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_4508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69490"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD9"
FT                   /inference="similar to AA sequence:KEGG:Daci_4508"
FT                   /protein_id="ACU69490.1"
FT                   /translation="MLTIIDLEGLGLDAGAHLVLNRALTGLPAGGRLAVVGGNQMLGVQ
FT                   LGAWCRSEGHGFDPADPPVVIKGTADDARARATQRAGSPSHVDERADAAWGLAARGALV
FT                   EPGGPLLSVDWVDRDLVWADVAPRLYSRAAAEQWDPATAIDWASHADVPDEVEDAVVQI
FT                   MTYLIENEQAALMLPARLLARLHPHFREVMQLFAVQIADEARHVEVFTRRALLSRDELG
FT                   VSGAGGRASLQTLLDEPDFTLASFLLSVLGEGSFLDLLRFLNVHAPDPITATMTSLVGR
FT                   DEARHVAFGVAHTAHAAKADARFLGRLRMAVERRHTALIDTAGLNKQVFDALVVLAAGS
FT                   WETSAIAKGWRAVEELQKRMEDGRRHRLSLIGFPDDEAAELAALHTRNFM"
     gtgctgacga ttatcgacct tgaggggctg gggctcgacg ccggagccca tctcgttctc        60
     aaccgggccc tgaccggcct gccagccggc gggcgcctgg ccgttgtcgg cggaaaccag       120
     atgctcgggg tgcaactcgg agcctggtgc aggtcggagg gccacgggtt cgaccccgca       180
     gacccgcccg tggtcattaa gggcacggcg gacgacgccc gagcccgcgc cactcagcgg       240
     gcgggatccc catcgcatgt cgacgagcgg gctgatgccg cgtgggggct tgcggctcga       300
     ggggctctcg tcgagcccgg cggcccgctt ttgtctgtgg actgggtcga ccgtgatttg       360
     gtttgggccg acgtggcgcc gaggctgtat tcgcgtgccg ccgccgaaca gtgggatccg       420
     gcgactgcta tcgactgggc ctcgcacgcc gatgtgcccg acgaggtcga ggacgcggtg       480
     gtccagataa tgacctacct gatcgagaac gaacaggcgg cactcatgct cccggcgcgc       540
     ctgctggcac gcctgcatcc gcacttccgc gaagtcatgc agttgttcgc cgtgcagata       600
     gccgacgagg cgaggcacgt cgaggtcttc acccgccgtg ccttgctgag ccgagacgaa       660
     ctcggcgtgt ccggggcggg tggacgcgcg tccctccaga ccctgctcga cgagcctgac       720
     ttcacactgg cctcgttcct gctgtcggtg ctcggggagg gcagttttct cgatctgctg       780
     cggttcctca atgtgcacgc gcccgatccg atcactgcga cgatgaccag cttggtcggt       840
     cgcgacgagg cccggcacgt ggcattcggt gttgcccata ctgcacatgc ggcgaaggcc       900
     gacgcgcgtt tcctcggacg cctccgcatg gcggtggagc gccgccatac agctctgatt       960
     gacacggcgg gcctcaacaa acaggtgttt gacgccctcg tcgtcctggc cgccggatcg      1020
     tgggagacct ctgcgatcgc gaagggctgg cgcgcggtcg aagagctgca gaagcggatg      1080
     gaagacggtc gtcgtcaccg gctgagcttg atcggctttc ccgacgacga agcggcagaa      1140
     ctcgctgctc tgcacacccg taacttcatg tga                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page