(data stored in ACNUC7421 zone)

EMBL: CP001700.PE536

CP001700.PE536       Location/Qualifiers
FT   CDS_pept        638631..638957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0553"
FT                   /product="selenocysteine synthase"
FT                   /note="KEGG: kra:Krad_1608 selenocysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69491"
FT                   /db_xref="GOA:C7PXE0"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE0"
FT                   /inference="similar to AA sequence:KEGG:Krad_1608"
FT                   /protein_id="ACU69491.1"
FT                   /translation="MSDVRRDIPRTDVVLADPRLAAARARLGVDAVKAAVRGAQQKARD
FT                   GEIAAEAVVEVAVASLPSSATTLRPILNATGVVLHTNLGRAPLAPAAVEACDGQKLGHQ
FT                   ADLG"
     atgtccgacg tgcgccgcga catacctcgg actgacgtcg tcctggcgga cccgcgcctc        60
     gccgcagccc gagcccgact cggtgtggat gccgtcaagg cagccgtccg cggagcccag       120
     cagaaagctc gcgacggcga aatcgccgca gaggcagtcg tggaggttgc cgtagcctcc       180
     ttgcctagtt ccgcgaccac cttgagaccc atcctcaatg ccactggcgt ggtgctccac       240
     acgaatctcg ggcgggcgcc tctcgcccct gccgctgtcg aggcctgtga tggtcagaaa       300
     ctcggccatc aggctgacct gggctga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page