(data stored in ACNUC7421 zone)

EMBL: CP001700.PE537

CP001700.PE537       Location/Qualifiers
FT   CDS_pept        638979..640052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0554"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   fre:Franean1_0474 integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69492"
FT                   /db_xref="GOA:C7PXE1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE1"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACU69492.1"
FT                   /translation="MAVGLLYRIFVSVLSWLALLARSQASKNAEILVLRQEVSVLRRTN
FT                   PKSRISWTARAVLAALSKLLPKTLRGHRIVTPGTLLRWHRRLVANKWRQPKAPGRPPIS
FT                   DGLVQLIVTMAQENRTWGAVRIQGELRRLGHRVAAATIRKVLRARRIPPPKHRDDSWRT
FT                   FLRTQADTLLATDFFHIDCAVTLARVYVAFVIEYSTRRVHLLGITRYPTAAWAIQLARD
FT                   FTADLETTGRRFTHLVRDRDAKFTAAFDAVLSAAGITAVTTMPQTPKMNAIAERFVGTV
FT                   RRDCTDRILVAGERHLRVILNGYIAHYNAGRSHQGAGMSLRAPDDDPNVIPFPAQIDQI
FT                   RRKRILGGLINEYEPAA"
     gtggctgtcg gtctgctgta ccggatcttc gtgagcgttc tgtcatggct ggctctattg        60
     gctcgatcgc aggcgtcgaa aaacgccgag atactcgtgt tgcgccagga ggtgtcggtg       120
     ctacgccgca cgaatccgaa gtcgagaatc tcctggaccg cccgagccgt gctcgcggcg       180
     ctgtccaagc ttctgcccaa gacccttcgc ggccaccgga tcgtcacccc gggcacgctg       240
     ctgcgctggc accgccgcct ggtcgcgaac aagtggcgcc agccgaaggc gccgggccgg       300
     ccaccgatca gcgacggact cgtccagctg atcgtcacca tggcacagga gaaccgcacc       360
     tggggcgcgg tacggatcca aggcgagctg cgccggctcg gacaccgcgt ggccgcggcc       420
     acgatccgca aggtcctgcg cgcccgccgg atcccgccgc cgaaacaccg cgacgactcc       480
     tggcgcacgt tcctgcggac ccaggccgat accctgctgg ccacggactt ctttcacatc       540
     gactgtgcag tcaccctcgc cagggtctac gtcgcgttcg tcatcgagta ctccacccgc       600
     cgggtccacc tgctcggcat cacccgatac ccgaccgccg cctgggccat ccagttggcc       660
     agggacttca ccgcagacct cgaaaccaca ggacgccgct ttacacacct cgtccgggac       720
     cgtgacgcca agttcaccgc cgcgttcgac gcggtcctca gcgccgccgg catcaccgcg       780
     gtcacgacca tgccgcaaac accgaagatg aacgccatcg ccgaacggtt cgtcggcacc       840
     gttcgtcgcg actgcaccga ccgtatcctc gtcgccggcg aacgccatct gcgtgtcatc       900
     ctgaacgggt acatcgcgca ctacaacgcc ggccgtagcc accaaggcgc cggaatgagc       960
     ttgcgcgccc cagacgacga tccgaacgtg atcccgttcc cagcccagat cgaccagatc      1020
     cgacgaaaac gcatcctcgg cggactgatc aacgagtacg agcctgccgc ataa            1074
//

If you have problems or comments...

PBIL Back to PBIL home page