(data stored in ACNUC7421 zone)

EMBL: CP001700.PE538

CP001700.PE538       Location/Qualifiers
FT   CDS_pept        640461..640973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69493"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69493.1"
FT                   /translation="MADDHLISEDETRRIAEAFVAGASWLGKPAWGKTGTGLLGAWHAP
FT                   GWYPEDEERDFGGQEGSWSWAVKTVDPSGQKQVLSHEKVLEGVRGLVFGETDDPLDQLA
FT                   IRKLKQWFTEPAAERHKLTLDDALSSRVCQQALFGRKVFPVGDEVSWSDKKPDWFEDQR
FT                   PTAEDAS"
     atggccgacg accacctaat cagcgaagac gagacgcgac gaatagccga ggcttttgtc        60
     gcgggcgcgt cctggcttgg taaaccggcc tggggaaaga cggggaccgg tctgcttggt       120
     gcgtggcacg cacctgggtg gtaccccgag gacgaagaga gagattttgg tggccaggaa       180
     ggtagctggt catgggcagt taaaacggtg gaccccagcg gccagaagca ggtcctcagc       240
     cacgaaaagg tcctcgaagg agtccggggt ctcgtcttcg gcgagacaga cgaccccctt       300
     gaccagcttg ctatccgcaa gctcaagcag tggttcaccg aaccagctgc tgagcgccac       360
     aagctgactc tcgatgatgc tctcagctcg cgcgtctgcc agcaggcgtt gtttggacgc       420
     aaggtcttcc ccgtgggcga cgaagtgtcg tggagcgaca agaagcccga ctggttcgag       480
     gaccagcggc cgacggctga ggacgcttcg tag                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page