(data stored in ACNUC7421 zone)

EMBL: CP001700.PE539

CP001700.PE539       Location/Qualifiers
FT   CDS_pept        641502..642491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0557"
FT                   /product="Glutamate--ammonia ligase"
FT                   /EC_number="6.3.1.2"
FT                   /note="PFAM: glutamine synthetase catalytic region;
FT                   glutamine synthetase beta-Grasp; KEGG: sgr:SGR_5302
FT                   putative glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69494"
FT                   /db_xref="GOA:C7PXE3"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE3"
FT                   /inference="protein motif:PRIAM:6.3.1.2"
FT                   /protein_id="ACU69494.1"
FT                   /translation="MGVPTAGLRAKTRVLADGAVPGVWGFDGSSTGQAEGRSSDRVLRP
FT                   VFTCADPVRGGDAVLVLCEVENIDFSPHSSNTRAEARGVAERFAEQEAWFGIEQEYTLF
FT                   RGGRPLGFPEGGGFPAPQGPYYCGVGGGAVFGRELVERHLDYCLAAGLTIAGINAEVMP
FT                   GQWEFQVGPAGPVEVADHMWVARYLLLRVAEEFGVSVSFDAKPEKGDWNGAGAHTNFST
FT                   KAMRESYDPIITACEALGEGDKPAEHVRAYGSGIEDRLTGQHETAPWSEYSYGVSNRGA
FT                   SVRIPWQVEVDKKGYIEDRRPNANVDPYVVTRLIVDTCCSALEKAGQV"
     gtgggggtgc ccacggcggg gctgcgggcg aagacgcggg tgctcgcgga cggggctgtg        60
     ccgggggtgt gggggttcga cgggtcttcg acggggcagg cggaggggcg gtcttcggat       120
     cgggtgctgc ggccggtgtt cacctgcgcg gatccggtgc ggggtgggga tgcggtgctg       180
     gtgctgtgtg aggtggagaa catcgacttc tctcctcact cctccaacac gcgggcggag       240
     gctcgggggg ttgccgagcg gttcgctgag caggaggcgt ggttcgggat cgagcaggag       300
     tacacgctct tccggggtgg gcggcctctg ggctttccgg agggtggtgg ctttccggcg       360
     ccgcagggtc cttactactg cggggtgggt ggcggcgctg tcttcgggcg ggagctggtg       420
     gagcggcatc tggactactg cctggctgcc gggctgacga tcgcggggat caacgccgag       480
     gtcatgccgg ggcagtggga gttccaggtc gggccggccg ggccggtgga ggtggccgac       540
     cacatgtggg tggcgcgcta tctgctgctg cgggtcgccg aggagttcgg ggtgtcggtg       600
     tcgttcgacg ccaagcccga gaagggtgac tggaacggcg ccggggcgca caccaacttc       660
     tccaccaagg ccatgcgcga gtcgtacgat ccgatcatca ccgcgtgtga ggcgctgggg       720
     gagggcgaca agccggccga gcacgtccgc gcgtacggct ccggcatcga ggaccgcctc       780
     accggccagc acgagaccgc cccgtggagc gagtacagct acggcgtctc gaaccgcggc       840
     gcctcggtcc gcatcccgtg gcaggtcgag gtggacaaga agggctacat cgaggatcgg       900
     cggccgaacg cgaacgtcga cccgtatgtg gtgacccggc tcatcgtgga cacctgctgc       960
     agcgcactgg agaaggccgg acaggtatag                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page