(data stored in ACNUC7421 zone)

EMBL: CP001700.PE54

CP001700.PE54        Location/Qualifiers
FT   CDS_pept        55176..56021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0054"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB (PSPase-
FT                   like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: sma:SAV_4604 morphological
FT                   differentiation- associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69009"
FT                   /db_xref="GOA:C7QFS0"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFS0"
FT                   /inference="protein motif:TFAM:TIGR01490"
FT                   /protein_id="ACU69009.1"
FT                   /translation="MDEHADARADGAGRPAAFFDLDKTIIAKSSTLAFGRSFYNGGLIN
FT                   RRTVLRTAYAQFVYLAGGADHDQMERMRQFLSAMATGWDVEQVKEIVAETLHDLIDPLI
FT                   YSEAAALIAEHKAAGRDVVIVSTSGSEVVEPIAEMLGADLAIGTRMAVGEDGKYSGEIE
FT                   FYAYAENKAKAIVELAAERGYDLTRSFAYSDSATDVPMLESVGHPYAVNPDRTLRKEAT
FT                   AREWPILVFDKPVALRSRVGELAAKPAVSGTALGLALATAGTIWWLGTRGRRRRGSGLL
FT                   "
     gtggatgagc atgcggacgc acgtgcggat ggcgcgggcc gtccggcggc cttcttcgac        60
     ctggacaaga cgatcatcgc caagtcctcg accctggcct tcggccggtc gttctacaac       120
     ggcggcctga tcaaccggcg caccgtgctg cggacggcgt acgcgcagtt cgtgtacctg       180
     gcgggcggtg cggaccacga ccagatggag cggatgcggc agttcctgtc ggccatggcc       240
     accggctggg acgtcgaaca ggtcaaggag atagtcgccg agaccctgca cgacctgatc       300
     gacccgttga tctactccga ggccgcggcg ctgatcgccg agcacaaggc cgcggggcgc       360
     gacgtggtga tcgtctccac ctccggctcg gaggtggtcg agccgatcgc cgagatgctc       420
     ggcgcggacc tggcgatcgg cacgcggatg gcggtcggcg aggacggcaa gtacagcggc       480
     gagatcgagt tctacgccta cgccgagaac aaggcgaagg cgatcgtgga gctggccgcc       540
     gagcgcggct acgacctgac ccggtccttc gcctacagcg actcggcgac ggacgtcccg       600
     atgctggagt ccgtcggcca cccgtacgcc gtcaaccccg accgcaccct gcgcaaggag       660
     gccacggccc gcgagtggcc gatcctggtc ttcgacaagc cggtggcgct gcgctcccgg       720
     gtcggcgagc tggccgccaa gcccgcggtg tccgggacgg ccctcgggct cgccctggcc       780
     acggccggga cgatctggtg gctggggacc cgagggcggc gccggcgcgg ctcaggcctc       840
     ctctga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page