(data stored in ACNUC7421 zone)

EMBL: CP001700.PE540

CP001700.PE540       Location/Qualifiers
FT   CDS_pept        642722..644797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO6025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69495"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE4"
FT                   /inference="similar to AA sequence:KEGG:SCO6025"
FT                   /protein_id="ACU69495.1"
FT                   /translation="MPNLSRRELGLLGMGALALGAFGADHAVTAAEADLVAYPARLAGR
FT                   VAFLHVVAHPDDDLYFLNPDIADSVRTGGEVTTVVLTSAEAGGGASFAAARQHGLRSAY
FT                   ARMAGAEDDAPWRRSVLVTRGGEAELCELEADARVRLVFLDISMGSYTGSTPEDENHTP
FT                   LAALFQGTLTTRPVLQPSETSITAGVYTRDQLVGTLTDLMDHFLPTVVRTMDPDPERRG
FT                   IGPKERAWLTDSGVHTDNEDHTAAAWFTYAAYADHRARRGPSAVRLDSYVGYGNARWRH
FT                   NLGGSSAREKLRLLGVYGWADRRKCGDPVGCGDRTVGGDAARPGWSQSTNLRHVGTTDW
FT                   LRTGPDGRLRAFAVVGGHAVVWSETAPGSGKFSPGKAVNADQSTVSSLTPHLAVSVGLD
FT                   RRAQLVGLRAATDPDRGTWTQEVVVSGERPDGSFTPWTALGAPTGAQTKDAHAVGCPTA
FT                   IVDGRGMLHVFVRNADMTVSWRRRDLVTPGATWTDWRDIGGRRVRDGLTTALTPEGDIE
FT                   LHAVGRTLWTWRIGAGATGEPQRTHSALPPMGDPPTVHALQGGGALLAARAADTGVLTV
FT                   LSRPSGGAWRPCAGKLGGQGGFGVVAIQPHGGGVFLAQRGRRGVVEVVWQAQVGTAGGV
FT                   RRWLGGPGPILRPSLTVDAHGRVVAAAIGPEGALYTARINAGDVPRTLTWQSTALA"
     gtgcctaact tgtctcgtcg cgagctcggt ctgctcggga tgggagcact ggcgctcggc        60
     gcgttcggtg ccgatcacgc cgtcactgcc gccgaggccg acttggtcgc gtatccggcc       120
     cggcttgccg gccgggtcgc gttcctgcat gtcgtcgcgc atccggatga cgatctctac       180
     tttctgaatc cggacatcgc cgactcggtg cgcactgggg gtgaggtgac cacggtcgtg       240
     ctcacgtcgg ccgaggccgg gggtggtgcg tccttcgcgg cggcgcgcca gcacgggctg       300
     cgctcggcgt acgcgcgcat ggcgggggcg gaggacgacg ctccgtggcg ccgcagcgtg       360
     ttggtcaccc gtgggggtga agccgagctg tgtgagctgg aggcggacgc gcgggtgcgg       420
     ctggtctttt tggacatctc catgggcagc tacaccggct ccacgcctga ggacgagaac       480
     cacacgccgc tggcagctct cttccaaggc acgctgacga cccgtccggt cctgcagccg       540
     agcgagacct cgatcaccgc cggcgtctac acccgggacc agctcgtcgg cacgctcacc       600
     gacctgatgg accacttcct gccgaccgtc gtgcgcacca tggaccccga ccccgaacgg       660
     cgcgggatcg gcccgaagga gcgcgcctgg ctgaccgact ccggcgtgca caccgacaac       720
     gaggaccaca ccgccgccgc ctggttcacc tatgcggcct acgccgacca ccgggcccgc       780
     cgcggaccct ccgccgtccg cctggactcc tacgtcggct acggcaacgc ccgctggcgc       840
     cacaacctcg gcggctccag cgcccgcgag aagctccgcc tgctcggcgt ctacggctgg       900
     gccgaccggc gcaagtgcgg cgaccccgtc ggctgcggcg accgcacggt cggcggcgac       960
     gcggcacgtc cgggctggtc gcagagcacg aacctgcgcc acgtcgggac caccgactgg      1020
     ctccgcaccg gcccggacgg acggctccga gccttcgcgg ttgtgggcgg tcacgcggtc      1080
     gtctggagcg agaccgcgcc tggcagcggc aagttcagcc cggggaaggc agtgaacgca      1140
     gatcagagca ctgtttcctc gctgactcct catcttgcgg tttcagtggg actcgatcgg      1200
     cgcgcgcagc tcgttgggct tcgtgccgcc accgaccccg atcggggtac ctggacgcag      1260
     gaagtagtcg tctccggcga gcgccccgac ggcagcttca ccccctggac cgccctcggc      1320
     gcgccaaccg gcgcccagac caaggacgcc cacgccgtcg gctgcccgac cgcgatcgtc      1380
     gacggccgcg gcatgctcca cgtcttcgtc cgcaacgctg acatgaccgt gtcgtggcgt      1440
     cgtcgcgatc tcgtgacacc cggcgcgacc tggaccgact ggcgcgacat aggcggacgc      1500
     cgggtccgcg acggcttgac caccgcgctc actcctgagg gtgacatcga actccacgcc      1560
     gtcggccgca ccttgtggac ttggcgcatc ggcgccggtg cgaccggcga gccgcaacgc      1620
     actcattcag ccctcccccc aatgggtgac ccgccgacgg tccacgcact ccaaggcggc      1680
     ggtgcgctcc tggccgcccg cgccgccgac accggcgtcc tgaccgtcct gtcccgtccg      1740
     tccggcggcg cctggcgtcc ctgcgccggc aagctcggcg gccagggcgg cttcggcgtc      1800
     gtcgcgatcc agccgcacgg cggcggtgtc ttcctggctc agcgcgggcg tcgtggcgtg      1860
     gttgaggtcg tatggcaggc gcaggttggt acggcaggcg gcgttcgccg ctggctcggc      1920
     ggacccggcc cgatcctgcg tccctcgttg accgttgacg cgcacggtcg ggtcgtggct      1980
     gccgcgatcg gacccgaggg cgcgctctat acagcgcgga tcaacgccgg agatgtgccg      2040
     cggacgctga cctggcaatc gaccgcgttg gcttag                                2076
//

If you have problems or comments...

PBIL Back to PBIL home page