(data stored in ACNUC7421 zone)

EMBL: CP001700.PE541

CP001700.PE541       Location/Qualifiers
FT   CDS_pept        complement(644814..645221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0559"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ava:Ava_0978
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69496"
FT                   /db_xref="GOA:C7PXE5"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE5"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACU69496.1"
FT                   /translation="MDALHPRLLVTRFAEMFGFYEAVLPEMLGAKLMKGSAGGPYANWD
FT                   VEDQAVLILFDRAAMAALAGTRDLPASAAPAQDHTMFVCRVEDVDAGAELCVRHGATLV
FT                   VGPTDRPEWGPTMRTAHVRDPEGNLIELQSY"
     atggacgcgc tgcacccccg cctgctggtg acccgtttcg cggagatgtt cggcttctac        60
     gaggccgtgc tgcccgagat gctcggcgcg aagctgatga agggctccgc gggcgggccg       120
     tacgccaact gggacgtcga ggaccaggcg gtcctgatcc tgttcgaccg cgcggcgatg       180
     gccgccctgg ccgggacccg ggacctgccg gcgagcgccg cgcccgcaca ggaccacacg       240
     atgttcgtgt gccgcgtcga ggacgtggac gccggcgctg agttgtgcgt gcgacacggc       300
     gcgacgctgg tcgtcgggcc gacggaccgt ccggagtggg gtccgacgat gcggaccgct       360
     catgtgcggg atcccgaggg gaacctgatc gagttgcagt cgtactaa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page