(data stored in ACNUC7421 zone)

EMBL: CP001700.PE542

CP001700.PE542       Location/Qualifiers
FT   CDS_pept        645280..645768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0560"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: fre:Franean1_3989 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69497"
FT                   /db_xref="GOA:C7PXE6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE6"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU69497.1"
FT                   /translation="MDDLQTAPPSLTSLTTYLLSRTGKIARGRLAERFSERGLRLWHHA
FT                   VLAALADFGPHVQRDLAARLAIDPSDMAKIIDELAGRGTVERARDAADRRRITVTLTDA
FT                   GRTLLAELDAEADVVQSEVLEPLTKDEREQLHALLGKVFEENNSRRAVDSARPVRRQG"
     atggatgacc tgcagacggc gccgccttct ctgaccagcc tgaccaccta cctgctctcg        60
     cggaccggga agatcgctcg cgggcggctg gctgagcgtt tctccgagcg cgggctgcgg       120
     ctgtggcacc acgcggtgct ggcggcgctc gccgatttcg ggccgcacgt gcagcgcgac       180
     ctcgcggcgc ggttggcgat cgatcccagc gatatggcga agatcatcga cgagctggct       240
     gggaggggaa ccgtcgagcg ggcccgggac gccgcggacc gtcggcgcat caccgtcacg       300
     ctcaccgacg ccggccggac attgctcgcc gagctggacg cggaagccga tgtcgtccag       360
     agcgaggtcc tggaaccgct cacgaaggac gagcgagagc agttgcatgc cctgctcggg       420
     aaagtgttcg aggaaaataa ttcgcgaagg gctgtcgatt ccgcgcgacc cgttcgacgg       480
     caggggtga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page