(data stored in ACNUC7421 zone)

EMBL: CP001700.PE543

CP001700.PE543       Location/Qualifiers
FT   CDS_pept        645797..646144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0561"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: kra:Krad_2755 DGPFAETKE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69498"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE7"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ACU69498.1"
FT                   /translation="MAQYAILLFDTAGAGDYTPEQQQASQRHAEDLIESGVLSSAYALD
FT                   SVETATSVRGDAVTDGPFIDAKEVVAGFYVVEAPDLDAALELAKRNPAVQWGRGGIEVR
FT                   PVVGSLPPSTR"
     atggcccagt acgcgatcct cttgttcgac accgcgggtg ccggcgacta cacccccgag        60
     cagcagcagg cgagccagcg gcacgccgag gacctcatcg agtccggcgt cctgagcagc       120
     gcctacgccc tggattccgt cgagaccgcc acctccgtgc gcggcgacgc ggtcaccgac       180
     gggcccttca tcgacgccaa ggaggtcgtc gccgggttct atgtcgtcga ggctcccgac       240
     ctggacgcgg cgctggagct ggccaagcgc aatccggccg tgcagtgggg gcgcggcggc       300
     atcgaagtgc ggcccgtcgt gggcagcctt ccgcccagca ctcgatga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page