(data stored in ACNUC7421 zone)

EMBL: CP001700.PE544

CP001700.PE544       Location/Qualifiers
FT   CDS_pept        646141..647436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0562"
FT                   /product="putative RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; KEGG: saq:Sare_0956 RNA polymerase
FT                   ECF-subfamily sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69499"
FT                   /db_xref="GOA:C7PXE8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACU69499.1"
FT                   /translation="MTDADDVARAVADAHRREWAFVLAATVRVAQDFDLAEECVQEAYA
FT                   AALSAWRRDGVPAKPAAWLTTTAKRRAMDAIRRERTLRSKLPLLIELEGREGQEDQEAR
FT                   EGQQHHQDQADPEATVPDERLRLIFTCCHPALAQEAQLALTLRLVCGLSTPDTARMLLV
FT                   SESTMAARITRAKKKISAARIPFRVPRAAELPDRLGAVLGVVHLLFTAGHTAPSGPDLL
FT                   RTELTDRALFLARTLRDLMPDEPEVRGLLALFLVTDTRRATRTDADGRLLRLEEQDRSQ
FT                   WDGEALAEAHELIVAGLRGGRAGRYLLQAAIASLYAQAPTYEETDWSQLVVLYDRLLAV
FT                   WPSPTVALNRTVPLSMAQGPEKAFDAVAELEKDDRLARYPYLPAIKADLWRRLGRDAEA
FT                   TKAYRQALELTDNEAERAFLAGRAGETGPPVR"
     atgacggacg ccgacgacgt cgcgcgggcg gtcgccgacg cgcatcgccg cgagtgggcc        60
     ttcgtgctcg ccgcgacggt gcgcgtcgcg caggacttcg acctggccga ggaatgtgtc       120
     caggaggcgt acgccgccgc gctgtcggcg tggaggcgtg acggcgttcc cgccaagccc       180
     gcggcgtggc tgacgaccac tgccaaacgg cgcgcgatgg acgccatccg ccgcgaacgc       240
     acgctccgct cgaagctccc actcctgatc gagctggaag gtcgcgaagg tcaggaagac       300
     caagaagccc gagaaggcca acagcaccac caagaccaag ccgacccgga agccaccgtc       360
     cccgacgaaa ggctccgcct catcttcacc tgctgccatc ccgcgctcgc ccaagaagcg       420
     cagctggcgc tgaccctgcg gctggtctgc ggcctgtcga cgccggacac cgcgcggatg       480
     ctgctggtct ccgaatcgac gatggcggcc cggatcaccc gcgcgaagaa gaagatctcc       540
     gcggcgcgca tccccttccg tgtgccgcgc gcggcggagc tgcccgaccg gctcggcgcc       600
     gtcctcgggg tcgtccacct gctgttcacc gccggtcaca ccgcgccttc gggccctgat       660
     ctgctgcgca cggagctgac cgaccgagcc ttgtttctgg cgcgcaccct ccgtgacctc       720
     atgcccgacg agcccgaggt gcgcggcctg ctcgcgctgt tcctcgtcac cgacacccgg       780
     cgcgccaccc gcaccgacgc cgacggccgt ctactccgcc tggaagagca ggaccgctcc       840
     cagtgggacg gggaggctct ggccgaggcg cacgaactga tcgtcgccgg actgcgcggc       900
     ggccgtgccg ggcgctatct cctgcaggcg gcgatcgcat cgctgtacgc gcaggcgccg       960
     acgtacgagg agacggactg gtcgcagctc gtggtcctgt acgaccggct cctcgccgtc      1020
     tggccgtcgc cgaccgtggc gctcaacaga accgtgccgc tgtcgatggc tcagggtccg      1080
     gagaaagctt tcgacgccgt cgctgagttg gagaaagacg atcggctggc gcggtatccg      1140
     tacctgccgg cgatcaaggc ggatctgtgg cgccgtctcg gccgcgacgc ggaagcgacg      1200
     aaggcctacc gccaagcgtt ggagctcacc gacaacgaag ccgagcgggc tttcctcgcc      1260
     ggtcgagcag gggaaaccgg gccgcctgtt cgatag                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page