(data stored in ACNUC7421 zone)

EMBL: CP001700.PE545

CP001700.PE545       Location/Qualifiers
FT   CDS_pept        complement(647618..647857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69500"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69500.1"
FT                   /translation="MRTTQESENWAVEFIRTDGENQSLSVEDGFSTRGDAEYYGQCTWS
FT                   SPGGRGIEQVRVRQLPRGPWMPVAPASVCGGIRL"
     gtgcgaacga ctcaggagtc ggagaactgg gcggtcgagt tcatccgcac cgacggggag        60
     aatcagtcac tgtctgtcga ggacggcttc tcgacccgcg gggacgccga atactacggc       120
     cagtgcacat ggtcctcgcc cggcggccgg ggcatcgagc aggtacgggt gcggcagctg       180
     ccgcgcggcc cgtggatgcc ggtggctcca gcctcggtct gcggagggat ccgcctctag       240
//

If you have problems or comments...

PBIL Back to PBIL home page