(data stored in ACNUC7421 zone)

EMBL: CP001700.PE546

CP001700.PE546       Location/Qualifiers
FT   CDS_pept        648081..649745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0564"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_2802 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69501"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXF0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69501.1"
FT                   /translation="MSRKPRSLKQIQVQLSEQLRASDHSWADIGREFQRRFHVNARVAL
FT                   RQARGWTQPEAAERWNRRWPEDPKTFKNFSYWEAWPSSTGYAPSLEVLDRMAQLYECSV
FT                   ADLLSDLDDYGAKKRPLFSQIREPGPGGSMSLPPPRQAPQSYALAAAVQNPDVRFDPYF
FT                   GAPPPKPLRDDVGTNPGELLSSMSSAAEISSLIEPPDGGNSLSRRSALLNLSSLFAVAA
FT                   AAPLAGEAVLPTPAGRVDPAMVENTGLIVGGLRQQNAALGPSATLQTGLAVRAMMEAVV
FT                   KDAPPGLTGQAWVVYGDLAHLLGWMMFNMGQDEAARFYYDDARKAAYQADDYELAANIL
FT                   AAQAHLSMSAGDHQTAIDHAQAAEEAAKRSPSRRAKAYAADMTARVYASAGQGARSLAA
FT                   LERERRQMQRIDWAEPAAERWGFYGPAFYWARESECHLLLGHPVEAADAGALAQQRFNP
FT                   AYLHNNAMALARRAQAQVQFGDVPAACKALAEAARMATLAGSVRLTTEMTRARKQLAPY
FT                   NGEAVVQALDVRLDHYAKQRGAVDNGGRPANSMEEVL"
     atgagcagga aacccaggag tctgaaacag atccaggtcc agctgtccga acagctgcgg        60
     gcctccgacc attcctgggc cgacatcggc cgggagttcc agcggcggtt ccacgtcaac       120
     gcgcgtgtcg cgctgcgcca ggcccgcggc tggacccagc cggaggccgc ggagcggtgg       180
     aaccggcgct ggccggagga tccgaagacc ttcaagaact tctcctactg ggaggcctgg       240
     cccagctcca ccggctacgc gccgtcgctg gaagtgctgg accggatggc gcagctctac       300
     gagtgcagcg tcgcggacct cctgtccgac ctggacgact acggcgccaa gaagcgcccg       360
     ctgttcagcc agatcaggga accgggcccg ggcggctcga tgagcctgcc gccgccccgc       420
     caagctccgc agtcgtacgc acttgcggct gcggtccaga accccgatgt gcggttcgat       480
     ccgtacttcg gcgccccgcc gcccaagccg ctgcgggacg acgtcggcac gaaccccggc       540
     gagctgttgt cctccatgtc ctcggcggcg gagatcagtt ctctgatcga gccgccggat       600
     ggcgggaaca gcctgtcgcg gcgctcggcg ctgctgaatc tcagcagcct gttcgcggtc       660
     gccgccgccg cgccgctcgc gggtgaggcg gtcctgccga ccccggccgg ccgcgtggat       720
     ccggcgatgg tggagaacac cgggctgatc gtcggcggcc tgcgccagca gaacgccgcc       780
     ctgggaccgt ccgcgacact gcagacaggg ctcgcggtcc gcgcgatgat ggaagccgtg       840
     gtgaaggacg ccccgcccgg actgaccggc caggcctggg tcgtctacgg cgatctggcg       900
     cacctgctgg gctggatgat gttcaacatg ggccaggacg aggcggcccg gttctactac       960
     gacgacgccc gcaaggccgc ctaccaggcc gacgactacg agctggcggc gaacatcctg      1020
     gcggcgcagg cgcatctgag catgtccgcc ggggaccacc agaccgcgat cgaccacgcg      1080
     caggccgccg aggaggcagc caagcgcagc ccgagccggc gcgccaaggc ctacgccgcc      1140
     gacatgacgg cccgggtcta cgcctcggcc gggcagggcg cccggagcct ggcggcgctg      1200
     gagcgcgagc ggcggcagat gcagcgcatc gactgggccg agccggccgc cgagcggtgg      1260
     ggcttctacg gtccggcgtt ctactgggcc cgggagagcg agtgccactt gctgctcggg      1320
     cacccggtgg aggccgccga cgccggcgcc ctggcgcagc agcggttcaa tccggcctac      1380
     ctgcacaaca acgcgatggc gctcgcccgc cgggcgcagg cgcaggtgca gttcggcgac      1440
     gtcccggcgg cgtgcaaggc gctggcggag gcggcgcgga tggcgaccct ggccggttcg      1500
     gtgcggctca ccaccgagat gaccagggcg cgcaagcagc tggcgccgta caacggcgag      1560
     gcggtcgtgc aggcgctgga cgtgcggctg gaccactacg ccaagcagcg cggcgccgtc      1620
     gacaacggcg gccgcccggc gaattctatg gaagaggtct tataa                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page