(data stored in ACNUC7421 zone)

EMBL: CP001700.PE547

CP001700.PE547       Location/Qualifiers
FT   CDS_pept        649879..650730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0565"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   sen:SACE_2002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69502"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXF1"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ACU69502.1"
FT                   /translation="MSEPTPAHDGHDVDAIFDDLPSNIDTDVFSVARLYDFLLGGKHNF
FT                   APDRDFGRQLLAIEPNGRMILQQNRLFLARAIRVMLDDGVRQFLDLGSGIPTQNYVHEL
FT                   AHAVDPAARVVYIDNDPPAVSHSNYILRGDDNAGAVLADMTDAERVLGDPTVKSLIDFD
FT                   KPVGLTALAAWHFVDDHDDPAGVLEKYRRMLAPGSYLALTHATIDGATGDLVRDVQSQY
FT                   QAVMKNPSPRTRDQIAGFFEGFRILEPGIVNLPAWRPDKAEDAVGAENVWFYGALGKLT
FT                   AA"
     atgagcgaac cgactccagc gcacgacggc cacgacgtgg acgcgatctt cgacgacctc        60
     ccgtcgaaca tcgacaccga cgtgttcagc gtcgcgcggc tgtacgactt cctgctcggg       120
     ggcaagcaca acttcgcccc cgaccgggac ttcgggcggc agctgctggc gatcgagccc       180
     aacggccgca tgatcctgca gcagaaccgg ctgttcctgg cccgggcgat cagggtgatg       240
     ctggacgacg gggtccggca gttcctggac ctcggcagcg ggatcccgac gcagaactac       300
     gtgcacgaac tcgcccacgc cgtggacccc gccgcgcggg tcgtctacat cgacaacgac       360
     ccgccggcgg tgagccacag caactacatc ctgcgcggcg acgacaacgc cggcgcggtg       420
     ctggccgaca tgaccgacgc cgagcgcgtc ctgggcgacc ccaccgtcaa gtcgctgatc       480
     gacttcgaca agccggtggg gctgaccgcc ctggccgcct ggcacttcgt ggacgaccac       540
     gacgacccgg ccggcgtgct ggagaagtac cggcggatgc tggctccggg cagctacctg       600
     gcgctgacgc acgccaccat cgacggcgcc accggcgacc tggtccgcga cgtccagagc       660
     cagtaccagg cggtcatgaa gaacccctcg ccgcggaccc gggaccagat cgcgggcttc       720
     ttcgagggct tccggatcct ggagccgggc atcgtgaacc tgccggcctg gcgtcccgac       780
     aaggccgagg acgccgtcgg cgcggagaac gtctggttct acggggcgct gggcaagctg       840
     accgcggcct ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page