(data stored in ACNUC7421 zone)

EMBL: CP001700.PE548

CP001700.PE548       Location/Qualifiers
FT   CDS_pept        complement(650697..652721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0566"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   afw:Anae109_0026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69503"
FT                   /db_xref="GOA:C7PXF2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXF2"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ACU69503.1"
FT                   /translation="MDSPWIFTAFRAPADPGAAPDALQEIRHLRARILFDEGRRPAFRS
FT                   RAGDHADDQPQDHGAWHFAARRARDGAHGPPLGYVRLLTPVTASLYQSREFLGSTHYEE
FT                   VLSTEGLNPAAVFEHSRLVVEHRARKLGLGLHLNALAVAAAHELGAAAMIGTSGTADGQ
FT                   DRFHARFGFHPVPGTRRYVEKYTEDVVILLHRTEEGAGEHTALVDEYRLLFRYDLMEDA
FT                   GLAEPSVPLARSAQSSLSSLSSLSSRSAAKAEPSFTVPDRGPVWRDAPPRRLTAIGPSD
FT                   PHRWKPVLFEPAQPDARAAMTSLLNTGAVREVLDTVDAQLEELIRARDPGRVFDADALA
FT                   DARSDQLEGARPWAYGTWAWYPWSGRLVHVLPREEFRLVRTDRNRGKIDRPEQRRLLDK
FT                   RIGVIGLSVGNSAALTLAQEGVAGAFKLADFDTLSVSNLNRLRAGLHQIGVNKAVLAAR
FT                   QMFEIDPYLDIEIFPAGLTEDTVREFFLGGHGPIDLLVEECDTPWVKLAAREAARDLGV
FT                   PVVMDANDRGLLDIERFDREPHRPLLHGLLGALTPDDCLDLTFAERVDLILAMVDADRV
FT                   SPALAASIPEIGRTLSSWPQLASGVALGGALVTEAARRILLGSPCPSGRFYVDLEELIR
FT                   ADKNVVGATDSPGGTASGDPGPDPDPDPAQAAVSLPSAP"
     atggactccc cgtggatctt caccgccttc cgcgccccgg ccgacccggg cgcggcgccg        60
     gacgccctcc aggagatacg gcatctccgc gcccggatcc tcttcgacga aggccgccgc       120
     ccggccttcc gcagccgcgc cggcgaccac gccgacgacc agccgcagga tcacggcgcc       180
     tggcacttcg ccgcccggcg cgcccgcgac ggcgcgcacg gcccgccgct gggctacgtc       240
     cgcctcctga cacccgtgac cgcttccctt taccagtcca gggaattcct cggcagcacc       300
     cactacgagg aggtcctgag caccgagggc ctgaaccccg cggcagtgtt cgaacacagc       360
     cggctcgtcg tcgagcaccg ggcccgcaag ctcggcctcg gactgcacct gaacgccctg       420
     gccgtggccg ccgcccacga gctcggcgcg gcggcgatga tcggcacgtc cggcaccgcc       480
     gacggccagg accgcttcca cgcgcgcttc ggcttccacc cggtccccgg cacccggcgc       540
     tacgtcgaga agtacaccga agacgtcgtc atcctgctgc accgcaccga ggaaggcgct       600
     ggcgagcaca ctgccctggt cgacgagtac cggctgctgt tccgctacga cctgatggag       660
     gacgccggcc tcgccgagcc gtccgtcccg ctcgcccgct ccgctcagtc gtcgctgtcg       720
     tcgctgtctt ccctgtcctc gcgatccgcc gccaaagcag aaccctcatt caccgtcccc       780
     gaccgcggac cggtctggcg tgacgccccg ccgcgccgcc tcaccgcgat cggcccgtcg       840
     gacccgcacc gctggaagcc cgtcctgttc gagccggccc agcccgacgc ccgcgcggcg       900
     atgacctcgc tgctcaacac cggcgcggtc cgcgaggtcc tcgacaccgt cgacgcccag       960
     ctcgaggaac tgatccgggc ccgcgacccc ggccgcgtat tcgacgccga cgccctcgcc      1020
     gacgcccgca gcgaccagct ggagggcgcg cgcccctggg cctacggcac gtgggcctgg      1080
     tacccgtggt ccggccgcct ggtccacgtc ctgccccgcg aagagttccg cctcgtccgc      1140
     accgaccgca accgcggcaa gatcgaccgt cccgaacagc gcaggctgct ggacaaacgg      1200
     atcggcgtca tcggcctgtc ggtcggcaac agcgccgcgc tgaccctggc gcaggaaggc      1260
     gtcgcaggag ccttcaaact cgccgacttc gacaccctga gcgtgtccaa cctgaaccgc      1320
     ctgcgcgccg gcctgcacca gatcggcgtg aacaaggcgg tgctggcagc ccggcagatg      1380
     ttcgagatcg acccgtatct ggacatcgag atcttccccg ccggtctgac cgaggacacg      1440
     gtgagggagt tcttcctcgg cggccacggt ccgatcgacc tgctcgtcga agaatgcgac      1500
     accccgtggg tgaagctcgc cgcccgcgaa gccgcgcggg acctgggcgt gccggtggtg      1560
     atggacgcca acgaccgcgg tctgctggac atcgagcgct tcgaccgcga accgcaccgg      1620
     ccgctgctgc acggtctgct cggcgcgctg acccccgacg actgcctgga tctgaccttc      1680
     gccgaacgcg tggacctgat cctggccatg gtggacgccg accgcgtctc cccggcgctg      1740
     gcggccagca tcccggagat cggccgcacg ctcagcagct ggccgcagct cgcctccggg      1800
     gtggctctcg ggggcgcgct ggtgaccgag gccgcccggc ggatcctgct cggcagcccg      1860
     tgtccttccg gccggttcta cgtcgatctg gaggagctga tccgcgccga caaaaacgtg      1920
     gtgggcgcta cggattcgcc gggcggtacc gcgtcaggcg atcccggtcc cgatcctgat      1980
     cctgatccgg ctcaggccgc ggtcagcttg cccagcgccc cgtag                      2025
//

If you have problems or comments...

PBIL Back to PBIL home page