(data stored in ACNUC7421 zone)

EMBL: CP001700.PE549

CP001700.PE549       Location/Qualifiers
FT   CDS_pept        652838..653857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0567"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="KEGG: fre:Franean1_5756 3-oxoacyl-(acyl carrier
FT                   protein) synthase III; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) synthase III; PFAM:
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; 3-Oxoacyl-[acyl-carrier- protein (ACP)] synthase
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69504"
FT                   /db_xref="GOA:C7PXF3"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXF3"
FT                   /inference="protein motif:TFAM:TIGR00747"
FT                   /protein_id="ACU69504.1"
FT                   /translation="MTTRAAVVQGVGGCVPPRSVDNNELSSRLETSDAWIRERLGIGRR
FT                   YVADGVSTVDLAVEAGARALEMADAGAGLGPLDVVLLATTTPDRLCPASAPEVASRLGY
FT                   TGIAAFDVNAVCAGFVHALATGNALIRGHMADRVLVIGADTFTTLVDPADRLTASIFGD
FT                   GAGALVLRAGTPDEPGALRAFDLGSDGSQVATVEVPGGGARDRLGMPVANQRPYLVMDG
FT                   PAVFRRAVQEMTASSLRVLAKAKWDAGSVRRFVPHQANIRIIRGVAERLGIGAERVVAN
FT                   IEDVGNTVAASIPLALADAHDSGRLGAGERVLMTSIGAGLAWGSAVLTWPELQGKARL"
     gtgaccacac gcgcggcagt cgtccaggga gtgggcgggt gcgtgccgcc ccgctccgtc        60
     gacaacaacg aactgagctc acggttggag acctccgacg cgtggatcag agaacggctc       120
     ggcatcggcc ggcggtacgt cgccgacggc gtctcgaccg tggacctggc cgtggaggcc       180
     ggagcccggg ccctggagat ggccgacgcc ggcgccggac tcgggccgct ggacgtcgtg       240
     ctgctggcca ccacgacccc ggaccgatta tgcccggcgt cggcgccgga ggtggcctcg       300
     cggctggggt acaccgggat cgcggcgttc gacgtcaacg cggtgtgcgc gggtttcgtg       360
     cacgccctgg ccacggggaa cgcgctgatc cgggggcaca tggccgaccg ggtgctggtg       420
     atcggcgcgg acaccttcac caccctggtc gatcccgccg accggctgac cgcctcgatc       480
     ttcggcgacg gcgccggagc gctggtgctg cgggccggga cgccggacga gccgggcgcg       540
     ctgcgggcct tcgacctggg cagcgacggc tcgcaggtgg cgacggtgga ggtaccgggg       600
     ggcggggcgc gggaccggct ggggatgccg gtggcgaatc agaggccgta tctggtgatg       660
     gacggtcccg ccgtgttccg gcgcgcggtc caggagatga ccgcgtcctc gctgcgggtg       720
     ctggcgaagg cgaagtggga cgcggggtcg gtgcggcggt tcgttccaca ccaggcgaac       780
     atccggatca tccgcggggt cgcagaacgg ctggggatcg gcgcggagcg cgtggtcgcg       840
     aacatcgagg acgtggggaa cacggtcgcg gcgtcgatcc cgctggcact ggccgacgcg       900
     cacgacagcg gacggctcgg cgccggggag cgggtgctga tgacctcgat cggcgccggg       960
     ctggcgtggg ggtcggcggt gctgacgtgg ccggagctgc aggggaaggc acggttgtga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page