(data stored in ACNUC7421 zone)

EMBL: CP001700.PE55

CP001700.PE55        Location/Qualifiers
FT   CDS_pept        complement(56106..57116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0055"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; Ion transport 2 domain
FT                   protein; KEGG: sma:SAV_4367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69010"
FT                   /db_xref="GOA:C7QFS1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFS1"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACU69010.1"
FT                   /translation="MLPRAVPGPLRAVLKRVLLALGILVLSAVIVYLGRDGYRDSSGKP
FT                   IGWLTSFYYATVTLSTTGYGDVVPVSDSARLISTLFVTPLRVLFLLVLVGTTLEVLTER
FT                   TRNEWRQERWRSKVRDHTVVVGYGTKGSSAVQTLLKHGTTPESIVVVDTDPARIAEANR
FT                   RGLVGIVGDGSRSEVLERAEISKARHVVISAERDDTAVLTTLTVRRLTRRATVVASVRE
FT                   AENAPLLRESGASSVVTSSDTAGQLLGMATISPKVSQVVHDLLSHGEGLELLERPADTG
FT                   DVDKDPRALKEPVLAVIRGSRTMRFDDVAIGTIQLTDRLVVVRSVHNRRTDPGRR"
     gtgctgccgc gcgcggtccc gggcccgctg cgggcggtcc tcaagcgggt gctgctggcg        60
     ctgggcatcc tggtgctctc agcggtcatc gtctacctgg gacgggacgg ctaccgcgac       120
     tcctccggca agccgatcgg ctggctcacc agcttctact acgccacggt gaccctgtcg       180
     acgaccggct acggcgacgt ggtgccggtc agcgactcgg cccggctgat cagcaccctg       240
     ttcgtgacgc cgctgcgcgt gctgttcctg ctggtgttgg tcggcaccac cctggaagtg       300
     ctcaccgagc gcacccgcaa cgaatggcgg caggagaggt ggaggtcgaa ggtgcgggat       360
     cacacggtcg tggtcgggta cggcaccaag ggcagctcgg cggtgcagac cctgctcaag       420
     cacggcacca cgccggagtc gatcgtggtc gttgacaccg atccggcgcg gatcgccgag       480
     gccaaccggc gcggtctggt cggcatcgtc ggcgacggca gccgcagcga ggtgctcgag       540
     cgcgccgaga tcagcaaggc ccggcatgta gtgatcagcg ccgagcgcga cgacacggcg       600
     gtgctgacca cgctcacggt gcgccgtctc acccgccgcg ccacggtggt cgcctcggtc       660
     cgcgaggccg agaacgcgcc gctgctgcgc gagagcggcg cctcctcagt ggtcaccagc       720
     tccgacaccg ccgggcagct gttgggcatg gccaccatca gcccgaaggt cagccaggtc       780
     gtgcacgacc tgctgtccca cggcgagggt ctggagctgc tggagcggcc cgccgacacc       840
     ggagatgtcg acaaggaccc cagggcgctg aaggagccgg tcctggcggt gatccgcggg       900
     tcgcggacca tgcgcttcga cgacgtggcg atcggcacga tccagctgac cgaccggctg       960
     gtggtggtgc gctcggtgca caaccggcgc accgacccgg gacggcgtta g               1011
//

If you have problems or comments...

PBIL Back to PBIL home page