(data stored in ACNUC7421 zone)

EMBL: CP001700.PE550

CP001700.PE550       Location/Qualifiers
FT   CDS_pept        complement(654056..655348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0568"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   sgr:SGR_3807 putative NAD(P)H-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69505"
FT                   /db_xref="GOA:C7PYU9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR023932"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYU9"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ACU69505.1"
FT                   /translation="MSAYEAADNAFGDEGYPPPGNSAWFGGAPGVPALPGDGAPANGHE
FT                   FAPAAGFGTAPGGFGAAIGTAFADAGFGAMPTGGGDFGGANGAGFGGANGSGSGGASGT
FT                   GSGGANGASYGGANGGGYGAGDGFGGTNGSGSGSGGANGAGFGASHSSGTGSGSTSGRT
FT                   ALPDYPASSPNAVAYTDPGFGRQDFSAPPATRHAADPTSSSALLPALAHPGPPRPGPAG
FT                   DVLRLVAVTAGLGQPSTARILADRLAEAARARLGERGRQVLVEVLELRDLALDIAGAMV
FT                   AGFPGAKLRAALDAVEGADGLIAVSPIYTASYSGLFKSFFDVLDKDALTGKPTLIAATG
FT                   GTARHSLALDHALRPMFAYLRAFMVPTAVFAASEDWASTGENSLNERISRAGTELGDLM
FT                   AGTPAAGRRRRDEFEDVVPFEQRMAALRSGI"
     gtgagtgcat acgaggcggc ggacaacgcc ttcggcgacg agggctaccc gcccccaggc        60
     aacagcgcct ggttcggcgg agcaccagga gtcccagccc tccccggcga cggcgccccg       120
     gcgaacggcc acgagttcgc cccggcagcc ggcttcggca cggcgccggg cggcttcggc       180
     gcggccatcg gcaccgcctt cgccgacgcc ggattcggcg cgatgccgac cggtggcggc       240
     gacttcggcg gggcgaacgg cgctggcttc ggtggtgcaa atggcagcgg ctccggcggt       300
     gcgagcggca ctggctccgg cggtgcgaat ggcgctagct acggcggtgc gaacggcggc       360
     ggctacggcg cgggcgatgg cttcggtggc acaaacggca gcggctccgg ctccggcggt       420
     gctaacggcg ctggcttcgg cgcttctcac agcagcggca ccggctccgg ctcgacctcc       480
     ggccgcaccg ccctcccgga ctaccccgcc tcgagcccca acgccgtcgc gtacaccgac       540
     cccgggttcg gccgtcagga cttctccgcc ccgccggcca cgcgtcacgc cgccgatccg       600
     accagtagca gtgccctgct cccggcgctg gcgcacccgg gtccgccgcg tcctggtccg       660
     gccggcgacg tcctgcggct ggtggctgtc accgccgggc tcgggcagcc ctcgaccgcg       720
     cgtatcctgg ccgaccggct cgccgaggcg gctcgggcgc ggctgggcga gcgcgggcgg       780
     caggtgctcg tggaggtctt ggagctgcgc gatctggcgc tggacatcgc cggggcgatg       840
     gtcgccggct tcccgggcgc caagctgcgc gccgcgctgg acgccgtgga gggcgccgac       900
     ggcctgatcg ccgtcagccc catctacacc gccagctaca gcggcctgtt caagtccttc       960
     ttcgacgtcc tggacaagga cgcgctcacc ggcaagccaa ccttgatagc ggccaccggc      1020
     ggcaccgccc ggcactcgct ggccctggac cacgccctgc gcccgatgtt cgcctacctg      1080
     cgcgccttca tggtcccgac cgcggtcttc gccgcctccg aggactgggc gtcgaccggc      1140
     gagaacagcc tgaatgagcg catcagccgc gccggcaccg aactcggcga cctgatggcc      1200
     ggcacccccg ccgccggccg ccgccgccgc gacgagttcg aggacgtcgt gcccttcgag      1260
     cagcggatgg ccgcactcag gtccgggatc tga                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page