(data stored in ACNUC7421 zone)

EMBL: CP001700.PE551

CP001700.PE551       Location/Qualifiers
FT   CDS_pept        complement(655345..656469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0569"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   sco:SCO3296 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69506"
FT                   /db_xref="GOA:C7PYV0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR023934"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV0"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACU69506.1"
FT                   /translation="MSQMQFGVFTVGDVTPDPTTGRAPTEHERIKAMVTIAEHAEQAGL
FT                   DVFATGEHHNPPFVPSSPTTLLGWIAGRTSKLLLSTATTLITTNDPVKIAEDYAMLQHL
FT                   ADGRVDLTLGRGNTGPVYPWFGKDIRDGIDLALENYALLRRLWDEDVVDWSGRFRTPLQ
FT                   NFTAAPRPLDGVAPFVWHGSIRSPEIAEQAAYYGDGFFHNNIFWPKEHTQRMVALYRRR
FT                   FAHYGHGTEEQAIVGLGGQVFMRKNSQDAVREFRPYFDNAPVYGHGPSLEEFTAETPLT
FT                   VGSPEQVVERTLSFRAYAGDYQRQLFLLDHAGLPLKTVLEQIDLLGAEVVPVLRKEFAI
FT                   GRPAGVPDAPTHASLTARHDERSALSDTKEAIAP"
     gtgagccaga tgcagttcgg cgtcttcacc gtcggagacg tgacgcccga tcccacgacg        60
     ggccgtgcgc cgaccgaaca cgagcgcatc aaggccatgg tgaccatcgc cgagcacgcc       120
     gagcaggccg gcctggacgt cttcgccacc ggggagcacc acaacccgcc gttcgtcccg       180
     tcctccccca cgacgctgct cggctggatc gccgggcgca cctccaagct gctgttgagc       240
     accgcgacca cgctgatcac caccaacgac ccggtgaaga tcgccgagga ctacgcgatg       300
     ctccagcacc tggccgacgg ccgcgtggac ctgaccctgg gccgcggcaa caccggcccg       360
     gtctacccct ggttcggcaa ggacatccgc gacggcatcg acctggcgct ggagaactac       420
     gcgctgctgc gccggctgtg ggacgaggac gtcgtcgact ggtccggccg cttccgcacc       480
     ccgctgcaga acttcaccgc cgcgccccgg ccgctggacg gcgtcgcgcc cttcgtctgg       540
     cacggctcga tccgatcccc ggagatcgcc gagcaggccg cgtactatgg ggacggcttc       600
     ttccacaaca acatcttctg gcccaaggaa cacacgcagc gcatggtcgc gttgtaccgc       660
     cggcgcttcg cccactacgg gcacggcacg gaggagcagg cgatcgtcgg attgggcggc       720
     caggtgttca tgcggaagaa ctcgcaggac gcggtacgcg agttccggcc ctacttcgac       780
     aacgccccgg tgtacggcca cgggccctcc ctggaggagt tcacggccga gaccccgctc       840
     accgtgggca gcccggagca ggtcgtcgag cgcacgctgt ccttccgcgc ctacgccggc       900
     gactaccagc gccagctgtt cctgctggac cacgccggcc tgccgctgaa gacggtgctg       960
     gagcagatcg acctcctcgg cgcggaggtg gtcccggtac tgcgcaagga gttcgcgatc      1020
     ggccgcccgg ccggcgtccc agacgcgccg acgcacgcga gcctgacagc gcggcacgac      1080
     gagcggtcgg ctctgtccga cacgaaggag gccatcgcac cgtga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page