(data stored in ACNUC7421 zone)

EMBL: CP001700.PE552

CP001700.PE552       Location/Qualifiers
FT   CDS_pept        complement(656558..657637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0570"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_4408 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69507"
FT                   /db_xref="GOA:C7PYV1"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69507.1"
FT                   /translation="MAQVKDPTPVKDHAVRLVRFQRIEIDATRLVLSGIALALPVAIGA
FT                   ATDRLADGLTAVLGALLVSAAGHEGGWRARCVDLGASAAVGALVVWLGALIGAHGNLAS
FT                   VWIVAMAFGAAMAGGIGTLEARIAANATVFTVIGAHLGTGPESPGHIVLYVALGMAAAA
FT                   ALTLGTHALGRALSPLRRRELEGPPGPEWPFRRSVPKWRAGLRTWHGWQYAVRLVTSIA
FT                   VAEVVSQFRPGAHTYWIALTVTLVVLRDEAAAPMRALERGLGTTIGVLVGGGLIGVLPT
FT                   WGIVALIGVIGAVRPYLKLANYTAYAAVMTPLITMLNELGNDISWAVLRERVLDTLIGC
FT                   AIGLCVGYLPWRMWANRQR"
     atggctcaag tgaaggaccc gactcccgtc aaggaccacg ccgtgcgcct cgtccgcttc        60
     cagcggatcg agatcgacgc gacccggctg gtcctgtcgg ggatcgcgct ggcgctgccg       120
     gtcgcgatcg gcgccgcgac cgaccgcctg gccgacggtc tgaccgcggt cctgggcgcg       180
     ctgctggtca gcgcggccgg gcacgagggc ggatggcggg cgcgctgcgt cgacctcggc       240
     gcctcggcgg cggtcggcgc gctggtggtg tggctcggag cgctgatcgg cgcgcacggg       300
     aacctggcga gcgtctggat cgtcgcgatg gccttcggcg cggcgatggc cggcggcatc       360
     gggacgctgg aggcgcggat cgcggcgaac gcgaccgtgt tcaccgtcat cggcgcgcat       420
     ctgggcacgg gtcctgagtc gcccgggcac atcgtgctct acgtcgcgct cggcatggcg       480
     gcggcggccg cgctcaccct cggcacgcac gcgctcggcc gcgcgctgtc acccctccgg       540
     cgcagggaac tcgagggtcc gccgggaccg gagtggccgt tccggcgcag cgtgccgaag       600
     tggcgcgcgg ggctgcggac gtggcacggc tggcagtacg cggtacgcct ggtcacgtcg       660
     atcgcggtcg ccgaggtggt ctcccagttc cgacccggcg cccacacgta ctggatcgcg       720
     ctgaccgtga cgctggtggt gctgcgcgac gaggcggcgg cgccgatgcg cgccctggag       780
     cggggactcg ggacgacgat cggcgtgctg gtcggcggcg ggctgatcgg ggtactgccg       840
     acgtggggca ttgtggcgct gatcggcgtg atcggcgcgg tgcggccgta tctgaaactg       900
     gcgaactaca ccgcctacgc cgcggtgatg acaccgctga tcaccatgct gaacgagctc       960
     gggaacgaca tctcgtgggc ggtgctgcgc gaacgcgtct tggacaccct gatcggctgc      1020
     gcgatcgggc tgtgcgtggg ctatctgccc tggcggatgt gggcaaacag acagcgctga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page