(data stored in ACNUC7421 zone)

EMBL: CP001700.PE553

CP001700.PE553       Location/Qualifiers
FT   CDS_pept        657708..658031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0571"
FT                   /product="protein of unknown function DUF718"
FT                   /note="PFAM: protein of unknown function DUF718; KEGG:
FT                   sma:SAV_7285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69508"
FT                   /db_xref="GOA:C7PYV2"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV2"
FT                   /inference="protein motif:PFAM:PF05336"
FT                   /protein_id="ACU69508.1"
FT                   /translation="MRGVLVRVAIHTRLKPEGVTGYEQAHDDIPPEIPELLRAGGCTAW
FT                   TIWRNGVDLFHLVECEDWEALRAFLADKDDDRAWQARVGVFRDFSLVGGDQPLPMIFEL
FT                   PEG"
     atgaggggag tcctggtgcg ggtcgccatc cacacccggc tgaagcccga gggcgtcaca        60
     gggtacgaac aagctcacga cgacatcccg ccggagatcc ccgagctgtt gcgggccggc       120
     ggctgcaccg cctggacgat ctggcgcaac ggcgtggacc tcttccacct ggtcgaatgc       180
     gaggactggg aggcgctgcg ggcgttcctg gcggacaagg acgacgatcg cgcgtggcag       240
     gcgcgcgtcg gggtgttccg tgacttctcg ctggtgggcg gggatcagcc gctgccgatg       300
     atcttcgaac tgccggaggg ctga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page