(data stored in ACNUC7421 zone)

EMBL: CP001700.PE554

CP001700.PE554       Location/Qualifiers
FT   CDS_pept        658034..658873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0572"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: sma:SAV_7286
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69509"
FT                   /db_xref="GOA:C7PYV3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV3"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ACU69509.1"
FT                   /translation="MRIIDAHHHLWDLAVRDQPWTAELPALRRSFLLSDLEPLAAAAGV
FT                   SATVLVQTIHAADETPEMLALAETSDLVAGVVGWTDVAAPDFGERLSELRSGVGGRRLV
FT                   GIRHQVQELPDGGWLTRPDTRRGLRQLASNGLAFDLIVRADQIPACVAAARALPDLRFV
FT                   LDHLGKPNIASGEREPWASDIRALAELPNVACKLSGMVTEADAERWTVADLRPYSDLVL
FT                   EAFGPERLMFGSDWPVSTLAAGYPQVVETAMQLTSELSEAEREAVFGGTATEVYGLG"
     atgcggatca ttgacgcgca tcaccacctg tgggacctgg ccgtacgaga ccagccctgg        60
     accgccgagc tgcccgcgct gcgccgcagc ttcctgctgt ccgacctgga gccgctggcc       120
     gcggccgccg gcgtctcggc gacggtgctg gtgcagacca tccacgcggc cgacgagacg       180
     ccggagatgc tggcgctcgc cgagacatcg gatctcgtcg ccggagtggt gggctggacc       240
     gacgtcgccg caccggactt cggcgagcgt ctcagtgaac tgcgttccgg cgtaggcgga       300
     cggcgtctgg tgggcatccg gcaccaggtg caggagctgc cggacggcgg gtggctgacc       360
     cgcccggaca ctcgcagagg tctgcgacag ctcgcctcca atgggctggc cttcgacctg       420
     atcgtgcggg ccgaccagat cccggcgtgc gttgccgccg cgcgagccct ccctgacctg       480
     cgcttcgtcc tggaccacct gggcaagccg aatatcgcga gcggcgagcg cgagccttgg       540
     gcgtcggata tcagggccct ggcagagttg ccgaacgtcg cctgcaagct ctccggcatg       600
     gtcaccgagg ccgacgcgga gcggtggacg gtcgcggacc tgcggcccta ctccgatctc       660
     gtgctggagg cgttcggacc cgagcgcctg atgttcggca gcgactggcc ggtgagcacg       720
     ctggcggcgg gttacccaca ggttgtggaa accgcgatgc agctgacctc cgagctgagc       780
     gaggcggagc gggaagcggt gttcggcggt actgcgaccg aggtctatgg gctgggatag       840
//

If you have problems or comments...

PBIL Back to PBIL home page