(data stored in ACNUC7421 zone)

EMBL: CP001700.PE555

CP001700.PE555       Location/Qualifiers
FT   CDS_pept        complement(658881..659699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0573"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   stp:Strop_2137 tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69510"
FT                   /db_xref="GOA:C7PYV4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV4"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ACU69510.1"
FT                   /translation="MRAHHRVASRNARFQQWQTLLTNRQKRQRAGRFLVQGVRPLTLAA
FT                   EQGWRIEELLVDDDRRLSRWAEDFLDAAHTADADVIALPADMLAELGEKDQEAAPELLA
FT                   VVAMPPDDLIRIQITDTFLGVAFDRPAQPGNLGTLIRSADAFGADGVVVTGHAADVYDP
FT                   RTVRASTGSLFGLPTVRTQSHREVLEWLSETGVTVVGTDEDGDTDIEDYDFCAPTLFVV
FT                   GNEAVGMSTGWREACDRVLSIPMRGTASSLNAANAATVVLYEAARQRRQK"
     atgcgcgcac accaccgggt ggcttcccgc aacgccaggt tccagcagtg gcagaccctg        60
     ctcacgaacc gtcagaagcg ccagcgcgcg ggacgcttcc tcgtccaggg cgtccgtccc       120
     ctcaccctgg ccgccgaaca gggctggcgc atcgaggaac tgctggtcga cgacgaccgc       180
     cggctgtcgc gctgggccga ggacttcctc gacgccgccc acaccgccga cgccgacgtg       240
     atcgccctgc ccgccgacat gctggccgaa ctcggcgaga aagaccagga agcggcaccg       300
     gaactgctcg ccgtggtcgc catgcccccg gacgacctca tccgcatcca gatcacggac       360
     acgtttctcg gcgtcgcctt cgaccgcccc gcccaaccgg gcaatctcgg taccctgatc       420
     cgctcggcgg acgccttcgg cgccgacggc gtcgtcgtca ccggccacgc cgccgacgtc       480
     tacgatcccc gcaccgtgcg cgccagcacc ggatcgctgt tcggtctgcc gaccgtgcgc       540
     acgcagtccc accgcgaagt gctggagtgg ctgagcgaaa ccggcgtcac ggtcgtcggc       600
     accgacgagg acggcgacac cgacatcgag gactacgact tctgcgcccc gaccctgttc       660
     gtcgtcggca acgaggcagt cgggatgagc accggctggc gcgaggcgtg cgaccgtgtt       720
     ctgagcatcc ccatgcgcgg aacagcgagt tcactgaacg ccgccaacgc cgccacggtc       780
     gttctgtacg aagcggcgcg gcagcgcagg cagaagtag                              819
//

If you have problems or comments...

PBIL Back to PBIL home page