(data stored in ACNUC7421 zone)

EMBL: CP001700.PE556

CP001700.PE556       Location/Qualifiers
FT   CDS_pept        659717..660592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0574"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   bph:Bphy_2889 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69511"
FT                   /db_xref="GOA:C7PYV5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV5"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACU69511.1"
FT                   /translation="MAEPEDPSTSPQNSQPSQASPTYDDAERVLWADAGSGYEAVYAAL
FT                   CAHTIPALLDGAGVQDGSALLDVGTGTGTLVRAAVARGARVTAVDAEPSMLALARGKAP
FT                   EAEFLLAVVPDLPFEPDTFDAVVGNFVLDHFGRPKVAMRALRAIAKPGGRVAFTLWPAE
FT                   RSAGRSVFSRTGAMTEGWIPRQMPPLVLADDYPRTEEGLAGLFREIGLADVTTTVIDWE
FT                   HLTTAEEWWISMGSGVGPSGRTYQAQTPEVRAAFHENYLRVAAEMTDAEGTMRLPYRAL
FT                   LAVGTVVDSE"
     gtggccgagc ccgaagatcc atcgacatcc ccgcagaact cccaaccctc ccaggcttcc        60
     ccgacctacg acgacgccga gcgcgtgctg tgggccgatg ccggctcggg gtacgaagcc       120
     gtctacgccg ccttgtgcgc ccacacgatt cccgctcttc tcgacggcgc cggggtccag       180
     gacggcagtg ctctgctgga cgtcggcacc gggaccggca cgctcgtccg ggcggccgtg       240
     gcgcgcgggg cgcgggtgac ggcggtcgac gccgagccct cgatgctcgc actggcgcgg       300
     gggaaggcgc cggaggcgga gttcctgctg gcggtcgtgc cggatctgcc gttcgagccg       360
     gacacgttcg acgccgtggt cggcaacttc gtgctcgacc acttcgggcg gccgaaggtc       420
     gcgatgcggg ccctgcgcgc gatcgccaag ccgggcgggc gagtggcgtt cacgctgtgg       480
     cccgcggagc gctccgccgg gcggtcggtc ttctcccgga ccggagccat gaccgagggc       540
     tggatcccgc ggcagatgcc gccgctggtc ctcgccgacg actacccgcg gaccgaggaa       600
     gggctcgccg ggctgttccg cgagatcggt ctggcggacg tcaccaccac cgtcatcgac       660
     tgggagcacc tgacgaccgc ggaggagtgg tggatctcga tggggtccgg cgtcggtccg       720
     tccggccgta cctaccaggc gcagacccct gaggtccgcg ccgctttcca cgagaactat       780
     ctgcgtgtcg ccgccgagat gaccgacgcc gagggcacga tgcggctgcc gtaccgcgcg       840
     ctcttggcag tcgggacggt agtcgacagc gagtag                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page