(data stored in ACNUC7421 zone)

EMBL: CP001700.PE557

CP001700.PE557       Location/Qualifiers
FT   CDS_pept        complement(660744..661550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0575"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   NADP oxidoreductase coenzyme F420-dependent; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein; KEGG:
FT                   oan:Oant_3760 2-hydroxy-3-oxopropionate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69512"
FT                   /db_xref="GOA:C7PYV6"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV6"
FT                   /inference="protein motif:PFAM:PF03446"
FT                   /protein_id="ACU69512.1"
FT                   /translation="MTTKVAFLGLGAMGAPMAARVIGAGYEVVVWNRTAARTEPLVALG
FT                   AGAAADPAGAVAGAEFVITMLSDPAAVTAVAEAIAGALRPDAVLVEMSTIGPDGTERIR
FT                   GLIPASVGLVDAPVMGSVDRAADGTLAVLAGGTPQDLARVADLLKLFGNVTECGGPGTG
FT                   SARKLVLISGIVAGVAVVGETLALAEKLGLPDPRAVLEASPLGGLVARAFATGVDFSAE
FT                   MAAKDLRLAGEVLDLPVIAAAQRALEAVPDPDADLGEAVRALNAKR"
     atgacgacaa aggttgcttt cctgggactg ggcgcgatgg gcgcgccgat ggcggcgcgc        60
     gtcatcggcg ccggctacga ggtcgtggtg tggaaccgga cagccgcccg caccgagccg       120
     ctggtcgcgc tcggcgcggg cgcggcggcg gatccggccg gggcggtggc cggcgccgag       180
     ttcgtgatca cgatgctctc cgacccggcc gcggtgacgg ctgtcgccga ggccatcgcc       240
     ggagcgctgc gcccggacgc ggtcctggtc gagatgtcca cgatcggacc ggacggaacc       300
     gagcgaatca gaggcctgat tcccgcctcg gtcggcctgg tcgacgcccc ggtgatgggc       360
     agtgtggacc gcgccgccga cgggacgctg gcggtgctgg ccggcggcac gccgcaggac       420
     ctggcgcgcg tggccgatct gctgaagctg ttcggcaacg tcaccgaatg cggcggaccc       480
     ggaaccggct cggcccgcaa gctggtgctg atcagcggca tcgtcgccgg ggtggcggtg       540
     gtcggcgaga cactggcgct ggccgagaag ctcggtctgc ccgacccccg cgcggtgctg       600
     gaggccagcc cgctgggcgg actggtggcc cgcgccttcg ccaccggcgt cgacttctcc       660
     gccgagatgg ccgcgaagga cctgcggctg gccggcgagg tgctggacct gccggtgatc       720
     gccgccgcgc agcgcgcgct ggaggcggtc ccggacccgg acgccgatct cggcgaagcg       780
     gtgcgggcgc tgaacgcaaa gcgctga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page