(data stored in ACNUC7421 zone)

EMBL: CP001700.PE558

CP001700.PE558       Location/Qualifiers
FT   CDS_pept        complement(661606..662358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0576"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ace:Acel_1027 DivIVA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69513"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69513.1"
FT                   /translation="MSFNEYDGAPGGTGARRPERLSAEQIDAWEFPRAGLAHRGFDEEG
FT                   VLRFKRRVLGELQAAAQIETELRQRNDELTNQLRTTYAGSDPANGGAAAAPAAPSSFAP
FT                   EQRVTAAAVNAIAMAQRQAEEQIRAAEEYVRNVTEYARNQYTVTVNEGHRQGLLAAESA
FT                   FQRRSEQLSTSLHSLEQQLEFLKAFGVAFGVQVEGALEKAREEVHVMIKNIHQAFDALN
FT                   RNPPQSAGAPPVMGMAGLHAGSALPGTA"
     gtgagcttca atgagtacga cggagcaccg ggcggcactg gcgcccggcg cccggaacgg        60
     ctcagtgccg agcagatcga cgcctgggag ttcccgcgcg ccgggctggc gcaccgcggc       120
     ttcgacgagg agggcgtgct ccgcttcaag cggcgcgtgc tcggcgagct acaggccgcc       180
     gcccagatcg agaccgagct gcggcagcgc aacgacgagc tgaccaacca gctgcgcacc       240
     acctacgcgg gcagcgatcc ggccaacggc ggcgcggccg ccgcgccggc ggcgccctcg       300
     tcgttcgccc ccgagcagcg ggtcaccgcc gccgcggtca acgcgatcgc gatggcgcag       360
     cgccaggccg aggagcagat ccgcgcggcc gaggagtacg tccgcaacgt cacggagtac       420
     gcccgcaacc agtacacggt cacggtgaac gagggacacc ggcagggcct gctggcggcg       480
     gagtcggcgt tccagcggcg cagcgaacag ctctcgacca gcctgcactc gctcgagcag       540
     cagctggagt tcctcaaggc gtttggcgtc gccttcggcg tgcaggtgga gggcgcgctg       600
     gagaaggccc gcgaggaagt gcacgtcatg atcaaaaaca tccaccaggc cttcgacgcg       660
     ctgaaccgca acccgccgca gtccgcgggc gcgccgccgg tcatgggcat ggcgggcctg       720
     cacgccggct ccgccctgcc tggtaccgcc tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page