(data stored in ACNUC7421 zone)

EMBL: CP001700.PE559

CP001700.PE559       Location/Qualifiers
FT   CDS_pept        complement(662355..663470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0577"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; globin; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: sen:SACE_7206 flavohemoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69514"
FT                   /db_xref="GOA:C7PYV8"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV8"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACU69514.1"
FT                   /translation="MDPHLLRTSWAKVAQYGEQVPLFFYGHLFLSHPEVRAMFPPSMAA
FT                   QRDRLVAALGAVVANVDNLDSAVPFLQGLGRDHRKFAVEPGHYPAVGASLLATLEQFLG
FT                   PDWTPAVAESWTEAYGIVAKVMTDAAAAASESTPPWWEAEIVAHEVVGGRRDIARVTIA
FT                   TRQPYAYTAGQSMTLETAMAPARWRFYTPANPPRQDGLIELHIKLVGAVSWQLVNIMGV
FT                   GDRLRLGPPVGYQLTLASTAPGTDLLLIAGSTGVAPLRAIVEELARTPDHGRHVTLFYG
FT                   ARIGSDLYDLPRLEQLAAHHGWLSVIPVVSDDHAWEGRHGLVGDIAAAYGNWPGHEVFI
FT                   VGSAGMCEHTAARLKEAGVIPGAIHLEESQP"
     atggatccgc acctcctgcg cacctcctgg gcgaaggtcg cccagtacgg ggagcaggtc        60
     ccgctgttct tctacggcca cctgttcctc agccatcccg aggtgcgcgc gatgttcccg       120
     ccgtcgatgg cggcacagcg cgaccggttg gtcgccgccc tcggagccgt cgtggccaac       180
     gtcgacaacc tcgactcggc cgtgccgttc ctgcagggcc tgggccggga ccaccgcaag       240
     ttcgcggtgg agcccggcca ctacccggcg gtcggagcga gcctgctggc caccctggag       300
     cagttcctcg gaccggactg gacccccgcg gtcgccgagt cctggaccga ggcctacggc       360
     atcgtcgcca aggtgatgac cgacgccgcc gccgcagcct ccgaaagcac cccgccgtgg       420
     tgggaggccg agatcgtggc gcacgaggtg gtcggcggcc ggcgcgacat cgcgcgggtc       480
     accatcgcca cccggcagcc ctacgcctac accgccggcc agtccatgac gctggagacg       540
     gcgatggcgc cggcccgctg gcgcttctac accccggcca acccgccccg ccaggacggg       600
     ttgatcgaac tgcacatcaa gctcgtcggc gcggtgtcct ggcagctggt caacatcatg       660
     ggcgtgggcg accggctgcg cctgggcccg ccggtggggt accagctgac cctggcctcc       720
     accgccccgg gcaccgacct gctgctgatc gccggcagca ccggggtcgc gccgctgcgc       780
     gcgatcgtcg aggagctggc ccgcacgccc gaccacggcc gccacgtcac cctgttctac       840
     ggcgcccgca tcggcagcga cctgtacgac ctgccccgcc tggaacagct ggccgcgcac       900
     cacggctggc tgagcgtgat cccggtggtc tccgacgacc acgcctggga gggccggcac       960
     ggcctggtcg gcgacatcgc ggccgcctac gggaactggc ccgggcacga ggtgttcatc      1020
     gtcggttcgg ccgggatgtg cgagcacact gcggcccgct tgaaggaagc gggagtgatc      1080
     ccgggcgcca tccacctgga ggagagtcag ccgtga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page