(data stored in ACNUC7421 zone)

EMBL: CP001700.PE56

CP001700.PE56        Location/Qualifiers
FT   CDS_pept        complement(57158..58456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0056"
FT                   /product="MoeA domain protein domain I and II"
FT                   /note="PFAM: MoeA domain protein domain I and II; MoeA
FT                   domain protein domain IV; molybdopterin binding domain;
FT                   KEGG: sco:SCO3827 molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69011"
FT                   /db_xref="GOA:C7QH72"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH72"
FT                   /inference="protein motif:PFAM:PF03453"
FT                   /protein_id="ACU69011.1"
FT                   /translation="MSTSWAEARKIAGAAAIPLPVTRVPLAQARGTVLAESLSALVDLP
FT                   PFATSAMDGWAVAGPGPWRVTGRVLAGQEATRLGDGEAVEIATGARMPSGAEAVLRRER
FT                   GYVDAHSRLHVGEKGDDQDGPNHGASAAATTAAAPQRFYAAVTSGTTATRTPRGAELGL
FT                   PIGADIRPQGQESRRGETLLSAGTRVTPAVLGLAAAAGYDDLPVHERPRVALVVIGDEL
FT                   AGSGLPDGARIRDALGPMFTAWLDALGVEVTVSRVADDPRELLAVVASSPADLVITTGG
FT                   TARGPVDHVHRVLAELGARLLIDGVSVRPGHPMLLAQYGGTRQHRRFVAGLPGNPLAAV
FT                   AGFVTVVRPLLRRLAGLADTSHFLPLGDAVPTHPTDTRLVPVSVTEASAVPLRFTGPAM
FT                   LRGLALADGLAVVPPGGGVVALGAGQRVEVLTV"
     gtgagcacgt cctgggccga ggcccgcaag atcgccggcg ctgcggcgat ccccctgccg        60
     gtcacccggg tcccgctcgc ccaagcccgc gggacggtcc tcgccgagtc gctgtccgcg       120
     ctggtggacc tgccgccgtt cgcgacctct gcgatggacg gctgggcggt ggccggtccg       180
     ggaccttggc gggtcaccgg ccgggtgctg gccggccagg aggcgacgcg gctcggcgac       240
     ggcgaggcgg tggagatcgc caccggtgct cggatgccct ccggggcgga ggcggtcctg       300
     cggcgcgaac ggggatacgt cgacgcccac agccgactcc acgtcggcga gaaaggcgac       360
     gaccaggacg gccccaacca cggcgcttcg gccgcggcca cgactgccgc cgcaccgcag       420
     cgtttttacg ccgccgtcac gagcggcacc accgccaccc gcaccccgcg cggcgccgag       480
     ctgggactgc cgataggagc agacatccgg ccgcagggcc aggagtcgcg ccgcggcgag       540
     acgctgctgt ccgccgggac ccgcgtgacc cccgcggtcc tgggactggc cgccgccgcg       600
     ggctacgacg acctgccggt ccacgagcgt ccccgggtcg cgctggtcgt cataggcgac       660
     gagctggccg ggtcggggct gccggacggc gcccggatcc gcgacgcgct cgggccgatg       720
     ttcaccgcct ggctcgacgc gctcggggtc gaggtgaccg tgagccgggt cgccgacgat       780
     ccccgggagc tgctcgcggt cgtcgcctcc tccccggccg acctggtgat caccaccggc       840
     gggacggcgc gcgggccggt ggaccacgtg caccgggtgc tcgccgagct cggcgcgcgg       900
     ctgctcatcg acggcgtctc ggtgcggccg gggcacccga tgctgctcgc gcagtacggc       960
     ggcacccggc agcaccgccg gttcgtcgcc ggcctccccg gcaacccgct ggccgccgtc      1020
     gccggcttcg tcactgtcgt gcggccgctg ctgcgccggc tggcaggact cgcggacacg      1080
     tcacacttcc tgccgctcgg ggatgccgtc cccacccatc cgaccgacac tcgactcgtg      1140
     cccgtctccg tcaccgaagc ctccgcggtc cccctgcggt tcaccggccc ggcgatgctg      1200
     cgcggactgg cgctggccga cggactggcc gtcgtacctc cgggaggagg ggtggtcgcc      1260
     ctcggcgccg ggcagcgggt ggaggtgctg acggtctga                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page