(data stored in ACNUC7421 zone)

EMBL: CP001700.PE560

CP001700.PE560       Location/Qualifiers
FT   CDS_pept        complement(663476..663859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0578"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: mgi:Mflv_3264 globin"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69515"
FT                   /db_xref="GOA:C7PYV9"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV9"
FT                   /inference="protein motif:PFAM:PF01152"
FT                   /protein_id="ACU69515.1"
FT                   /translation="MSESQNQSQWERVGGEAAIKAVLDRFYEGVLDEPQLAGFFESVAV
FT                   DDIKPHMAEVLQVVLGGPGARTDIDLAGYLTEAHADLGVSLSDFELTGKVLLDTLEEFS
FT                   VPDDIVETIEGVLATVQPFVVAA"
     atgagcgaga gccagaacca gtcccagtgg gagcgtgtcg gcggggaggc agccatcaag        60
     gccgtcctcg accgcttcta cgaaggcgtg ctcgacgagc cgcaactcgc cggcttcttc       120
     gagagcgtcg cagtggacga catcaagccg cacatggcgg aggtgctcca ggtcgtgctc       180
     ggcggcccgg gcgcgcggac cgacatagac ctggcgggct acctcaccga ggcgcacgcc       240
     gacctcggcg tctcgctgtc cgacttcgag ctgacgggca aggtcctgct ggacacgctc       300
     gaggagttca gcgttcccga cgacatcgtg gaaacgatcg agggcgtact ggccacggtg       360
     cagcccttcg tggtggccgc gtag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page