(data stored in ACNUC7421 zone)

EMBL: CP001700.PE561

CP001700.PE561       Location/Qualifiers
FT   CDS_pept        complement(664125..665069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0579"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: sgr:SGR_3027
FT                   putative Zn-dependent protease with chaperone function"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69516"
FT                   /db_xref="GOA:C7PYW0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW0"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACU69516.1"
FT                   /translation="MSSSLSDRRTDARFRADRNLSARMLSVMVLLAAVYGAAILLMIRF
FT                   MGRAWPLGLAVVVAFAVFQILTSGKVAMRTMGAREVSAEEEPELHALVDRLCALSGMKK
FT                   PTIAVAESRIPNACAVGRSKGGATLCVTRSLLDTLDPPELEGVIAHEMAHIEHGDAAVM
FT                   TVAAFVGVLAGLVARVGLRFIYIGGRARGLWHIIVAAIGLIALATATWFVSLVLTRSLS
FT                   RYREFAADRSAAQLTGNPSALASALAKVEAKVHGGGGIPQTDLRKAGALNAFYFAPVTS
FT                   AKTTAHHLLSTHPTTQARLDRLVKMSTEMSKNG"
     gtgtcctctt ccctttcaga tcgccgtacc gacgcccgct tccgggccga ccgcaacctc        60
     agcgcgcgga tgctgtccgt catggtgctg ctggctgccg tctacggcgc cgcgatcctt       120
     ctgatgatcc gcttcatggg acgcgcctgg ccgctcgggc tcgccgtggt cgtcgccttc       180
     gccgtgttcc agatcctgac ctccggcaag gtcgcgatgc gcaccatggg tgcccgcgaa       240
     gtgagcgccg aggaggagcc ggagctgcac gctctggtcg accgcctctg cgccttgtcc       300
     ggtatgaaga agccgaccat cgcggtggcc gagtcccgga tcccgaacgc ctgcgccgtc       360
     ggacgctcca agggcggcgc taccctgtgc gtgacccgca gcctgctgga cacgctggac       420
     ccgccggagc tcgagggcgt catcgcccac gagatggcgc acatcgagca cggcgacgcc       480
     gcggtgatga ccgtcgcggc cttcgtcggc gtcctggccg gactggtcgc ccgggtcgga       540
     ctgcgcttca tctacatcgg cggccgggcc cgcggcctgt ggcacatcat cgtcgcggcc       600
     atcggcctga tcgccctggc caccgcgacc tggttcgtct cgctggtcct gacccgctcg       660
     ctgtcccgct accgcgagtt cgccgcagac cgctcggcgg cgcagctgac cggcaacccc       720
     tcggcgctgg cctccgccct ggcgaaggtc gaggccaagg tgcacggcgg aggcggcatc       780
     ccgcagaccg acctgcgcaa ggccggcgcg ctgaacgcct tctacttcgc ccccgtgacc       840
     tccgccaaga ccacagcgca ccacctgctg tccacgcacc cgacgacgca ggctcggctg       900
     gaccgcttgg tcaagatgtc tactgagatg tcaaagaacg gctaa                       945
//

If you have problems or comments...

PBIL Back to PBIL home page