(data stored in ACNUC7421 zone)

EMBL: CP001700.PE562

CP001700.PE562       Location/Qualifiers
FT   CDS_pept        complement(665201..666250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_6654 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69517"
FT                   /db_xref="InterPro:IPR025331"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW1"
FT                   /inference="similar to AA sequence:KEGG:SACE_6654"
FT                   /protein_id="ACU69517.1"
FT                   /translation="MTENWQQEPAPRLSTARDRAEAGPESIPVMPHGLKPVPMSRPGGP
FT                   RPDAPAPPYQPQSRWQEPQVYIANTYIDSPYTPPTPPPSQPPPTADPRIGNSRVGNPSD
FT                   GNSTMMVAVGTVQPAASRPPEVSTVEEAERILGYAVDSLDADPDLYSIGTVTDGAVCLI
FT                   PDDGRWSIFLADGGRRRYAGSFDNPEQAAIHFAGVLLIAAAERGALPKHAAGRAALPGR
FT                   STDPLAEMLAGPPITPLAGDPPTTLYSDQRLTILTPGTEVDRFGDQQGNTVYAARTRYP
FT                   HRSLPPDYIGRPYRVYRVRDPLRALTGTAIPWFGQPGGGMAYLLPRPIRDLLHEGALVE
FT                   IPSATLAPS"
     atgacggaga actggcagca ggaacccgca ccgcggctct ccaccgcgcg tgaccgtgcc        60
     gaagcaggtc cggagtcgat tccggttatg ccgcacggac tcaagccggt ccccatgtcc       120
     cgtcccggcg gtccgcgtcc ggacgctccg gcgccgccct accagccgca gtcacgctgg       180
     caggagccgc aggtctacat agcgaacacc tatatagaca gtccctatac gccgcccact       240
     ccgcctccct cacagccgcc cccgactgcc gacccgcgta tcggcaactc tcgcgtcggc       300
     aaccccagcg acggcaattc gacgatgatg gtcgcggtcg gcacggtcca gcccgccgcc       360
     tcgcgcccgc cggaggtcag caccgtcgag gaggccgaac gcatcctcgg ctacgccgtc       420
     gactccctgg acgccgaccc ggacctgtac tccatcggca cggtcaccga cggcgcggtc       480
     tgcctgatcc ccgacgacgg ccgctggtcc atcttcctgg ccgacggcgg acggcgccgc       540
     tacgccggct cgttcgacaa ccccgagcag gcggcgatcc acttcgccgg cgtcctgctc       600
     atcgccgccg ccgaacgcgg agcgctcccc aagcacgccg ccggacgcgc ggcgctgccc       660
     ggacgcagca ccgatccgct ggccgaaatg ctcgccggac cgccgatcac tcctttggcc       720
     ggcgatccgc cgaccacgct gtactccgac cagcgcctca cgatcctgac tccgggcacg       780
     gaggtggacc gcttcgggga ccaacagggc aacaccgtct acgcggcgcg caccaggtac       840
     ccgcaccgtt ccctgcctcc ggactacata gggcggccct acagggtgta ccgagtccgt       900
     gacccactgc gtgccctcac cggtacggcg attccgtggt tcggacagcc gggaggcggt       960
     atggcgtacc tgttgccgcg ccctataaga gaccttctcc atgagggagc cctggtagag      1020
     atcccctcgg caacactggc tccttcctaa                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page