(data stored in ACNUC7421 zone)

EMBL: CP001700.PE563

CP001700.PE563       Location/Qualifiers
FT   CDS_pept        complement(666299..667126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0581"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold protein; KEGG:
FT                   sma:SAV_7067 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69518"
FT                   /db_xref="GOA:C7PYW2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW2"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU69518.1"
FT                   /translation="MELSYARRGSGEPLVLIHGIGHRWQAWEPVLDRLAEHHDVIAIDI
FT                   PGFGKSAPLKLAAGQHPTIGLAMERIAESFPGFGIERPHVAGNSLGGALALELARHGLA
FT                   ASATAFSPAGFWHTRWETAWALGNLSLTRAAAFAPEPVLRYIADHETTRALAFGMIFGK
FT                   PRRLDPALALADTLALRAGRSFRPVGREAKHYRYAGESDVPTTVAWGTKDRILLRRQFA
FT                   QAKQVLPKARFEDLPGCGHVPMNDDPERVSRLILETTGALPAGTREVVGPSDL"
     atggaactct cctacgcgcg ccgcggctcg ggcgaaccct tggtcctgat ccacggcatc        60
     ggccaccgat ggcaggcctg ggaaccggtt ctggaccgcc tggccgaaca ccacgacgtc       120
     atcgcgatcg acatccccgg cttcggcaag tccgcgccgc tcaagctggc cgcgggtcag       180
     caccccacga tcgggctggc gatggagcgc atcgccgagt ccttccccgg cttcgggatc       240
     gagcgcccgc acgtcgccgg caactccctg ggcggcgccc tggcgctgga gctggcccgg       300
     cacggcctgg cggcctcggc gaccgccttc tccccggcag gcttctggca cacgcgctgg       360
     gagaccgcgt gggcgctggg gaacctgagc ctgacgcgcg ccgccgcctt cgcccccgaa       420
     ccggtcctgc gctacatcgc cgaccacgag accacccgcg ccctggcgtt cggcatgatc       480
     ttcggcaagc cgcgccgcct ggacccggcg ctggccctgg cggacaccct ggcgctgcgc       540
     gcgggccgct cgttccggcc ggtcggcagg gaggcgaagc actaccgcta cgccggcgag       600
     agcgacgtgc cgaccacggt ggcctggggc accaaggacc gcatcctgct gcgccgccag       660
     ttcgcccagg ccaagcaggt cctgccgaag gcgcggttcg aggatctgcc gggctgcggg       720
     cacgtgccga tgaacgacga ccccgagcgt gtcagccgcc tgatcctgga gacgacgggg       780
     gcgctgcccg ccggaacgcg agaggtcgta ggaccatccg acttgtag                    828
//

If you have problems or comments...

PBIL Back to PBIL home page