(data stored in ACNUC7421 zone)

EMBL: CP001700.PE564

CP001700.PE564       Location/Qualifiers
FT   CDS_pept        complement(667233..668954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0582"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   sma:SAV_3592 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69519"
FT                   /db_xref="GOA:C7PYW3"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW3"
FT                   /inference="protein motif:PFAM:PF02366"
FT                   /protein_id="ACU69519.1"
FT                   /translation="MTSLAPTRSSLPDDDSEEDYGGRRRGRSGSHRERGRVWWRPNLDP
FT                   RDDEQGELTLRERLVPSFAREPWWVTWGFPLLITLVGGFMRFWHLGLPKWVIFDETYYA
FT                   KDAWATIHFGHEIGWHDDGPGVGMANDDHAIIANPHIWRTLVANHQGNAVHPPVGKWMI
FT                   GAGEWLFGFTPFGWRFIPAVCGTLAILMTARIARRMFRSTLIGCLAGVLLAADGLEFVM
FT                   SRTALLDIFVMFWTLAAFGCFLVDRDKMRSRLVDWRESFPSTPLPDDVKAPPLGWRPWR
FT                   IAGAVCLGLDLGTKWSGLWIIPCFIAMSLLWDHAALRAVGIRRHWSGFLRRETWQTTLL
FT                   GLLVLATYAATWTGWFVTKDGNYRQWAAQNNAIHVPVLSALRSWWEYHWQTYHFHVNLD
FT                   SPHAYMSNPWSWLVMGRPTDYYYCSKGATGCPPLAADQHQQVLALGTPPLWWFASLALV
FT                   WCCWRWIARRDWRAGSILCGMLAAWAFWLNYQHRTIFTFYAVAFVPFMCLAAAYLLGVI
FT                   VGRSDALQYRRVWGAVVAGAITVYILVMFIYFYPILSAQTITYNQWLDRMWWPSWI"
     gtgaccagcc tcgccccgac ccgttcctcg ctgccggatg acgacagcga ggaggattac        60
     ggcggccgcc gccgcggccg tagcggctcg caccgcgaac gcggacgcgt ctggtggcgc       120
     ccgaacctgg acccgcgcga cgacgagcag ggcgagctga cgctgcgcga gcgcctggtc       180
     ccctccttcg cgcgcgagcc gtggtgggtg acctggggct tcccgctgct gatcacgctg       240
     gtcggcgggt tcatgcggtt ctggcatctg ggcctgccca aatgggtcat cttcgacgag       300
     acctactacg ccaaggacgc ctgggcgacc atccacttcg gccacgagat cggctggcac       360
     gacgacggcc cgggcgtcgg catggccaac gacgaccacg ccatcatcgc caacccgcac       420
     atctggcgga cgctggtcgc caaccaccag ggcaacgcgg tgcacccgcc ggtcggcaag       480
     tggatgatcg gcgccggcga gtggctgttc ggcttcaccc cgttcgggtg gcgcttcatc       540
     ccggcggtct gcgggaccct ggcgatcctg atgaccgcgc gcatcgcccg gcgcatgttc       600
     cgctccacgc tcatcggctg cctggccggc gtgctcctgg ccgccgacgg cctggagttc       660
     gtgatgagcc gcaccgcgct gctggacatc ttcgtgatgt tctggacgct ggccgccttc       720
     ggctgcttcc tcgtcgaccg cgacaagatg cgctccagac tcgtcgactg gcgggagagc       780
     ttcccctcca ctccgctgcc cgacgacgtc aaggcgccgc cgctgggctg gcgtccctgg       840
     cgcatcgccg gcgcggtctg cctggggctg gacctgggca ccaagtggag cgggctgtgg       900
     atcatcccct gcttcatcgc gatgtcgctg ctgtgggacc acgccgcgct gcgcgccgtg       960
     ggcatccggc gccactggtc cggcttcctc cgccgcgaga cctggcagac cacgctgctc      1020
     gggctgctgg tcctggccac ctacgccgcc acctggaccg gctggttcgt caccaaggac      1080
     ggcaactacc gccagtgggc cgcgcagaac aacgcgatcc acgtcccggt cctgtccgcg      1140
     ctgcgcagct ggtgggagta ccactggcag acctatcact tccacgtgaa cctggactcg      1200
     ccgcacgcgt acatgtcgaa cccgtggagc tggctggtca tgggccgccc caccgactac      1260
     tactactgct ccaagggcgc gacgggctgc ccgccgctgg ccgccgacca gcaccagcag      1320
     gtcctggcgc tcggcacgcc gccgctgtgg tggttcgcga gcctggcgct ggtctggtgc      1380
     tgctggcgct ggatcgcccg ccgcgactgg cgcgccggct cgatcctgtg cgggatgctc      1440
     gcggcgtggg cgttctggct gaactaccag caccggacga tcttcacgtt ctacgccgtc      1500
     gccttcgtgc cgttcatgtg cctcgcggcg gcgtacctgc tgggggtgat cgtcggacgc      1560
     tccgacgcgc tccagtaccg gcgggtctgg ggcgcggtcg tcgccggcgc catcaccgtc      1620
     tacatcctgg tgatgttcat ctacttctat ccgatcctgt cggcgcagac gatcacctac      1680
     aaccaatggc tcgaccgcat gtggtggccc agctggatct ag                         1722
//

If you have problems or comments...

PBIL Back to PBIL home page