(data stored in ACNUC7421 zone)

EMBL: CP001700.PE565

CP001700.PE565       Location/Qualifiers
FT   CDS_pept        669023..669910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0583"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: sco:SCO3153
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69520"
FT                   /db_xref="GOA:C7PYW4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW4"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ACU69520.1"
FT                   /translation="MTGTEPTPGLLVLAGTPIGQDEDASPRLAAELTAADVIATEDTRR
FT                   LKRLLRVLDLTPKARFVSYFEANESARTPDLLRDLLAGARVVVVTDAGMPSVSDPGYRL
FT                   VAAAVEAGVRVTAVPGPSAVLTALAVSGLPVDRFCFEGFLPRKGGGRSSRLTELSSEPR
FT                   TMVFFEAPHRLAASLADMAAALGTDRPAAVCRELTKTYEEIKRGTLADLAKWAADGEIR
FT                   GEITVVVGGALPGAGRDLSGAEIAELVFARETAGGLRRKEAIAEVAAELGLPKRDVFDA
FT                   VVAAKEAAEAADES"
     gtgactggaa cagaacccac cccgggcctg ctcgtcctcg ccggcacccc gatcggccag        60
     gacgaggacg cctccccccg gctggcggcc gagctgaccg cggcggacgt catcgccacc       120
     gaggacaccc gccgcctcaa gcgcctcctc cgggtgctgg acctcacacc caaggcccgc       180
     ttcgtctcct acttcgaagc gaacgaatcc gcccgcaccc ccgacctcct ccgcgacctc       240
     ctcgccggcg cccgcgtcgt cgtggtcacc gacgccggca tgccctccgt ctccgacccc       300
     ggctaccgcc tcgtcgccgc cgccgtcgaa gccggcgtcc gagtgacggc agtcccagga       360
     ccctcagcgg tcctgaccgc actggccgtc tcaggcctcc ccgtcgaccg cttctgcttc       420
     gaaggcttcc tcccccgcaa gggcggcgga cgctcctccc gcctgacgga actttcatca       480
     gaaccccgca ccatggtctt cttcgaggca ccccaccgcc tcgccgcctc cctggccgac       540
     atggcggcag ccctcggcac cgaccgccca gcggccgtct gccgcgaact gaccaagacc       600
     tacgaggaga tcaagcgcgg aaccctcgcc gacctggcga aatgggccgc cgacggcgaa       660
     atccgcggcg agatcaccgt agtcgtcggc ggcgcgctcc ccggcgcggg ccgagacctg       720
     agcggcgcgg agatcgcaga gctggtgttc gcgcgagaga cggccggggg cttgcggcgc       780
     aaggaggcga tcgcggaggt cgccgccgag ctcgggctgc cgaagcggga cgttttcgac       840
     gcggtggtgg cggcgaagga agcggctgag gcagcggacg agagctga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page