(data stored in ACNUC7421 zone)

EMBL: CP001700.PE566

CP001700.PE566       Location/Qualifiers
FT   CDS_pept        complement(669986..670357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0584"
FT                   /product="death-on-curing family protein"
FT                   /note="TIGRFAM: death-on-curing family protein; PFAM:
FT                   filamentation induced by cAMP protein Fic; KEGG:
FT                   mav:MAV_3971 death-on-curing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69521"
FT                   /db_xref="GOA:C7PYW5"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW5"
FT                   /inference="protein motif:TFAM:TIGR01550"
FT                   /protein_id="ACU69521.1"
FT                   /translation="MRYLTTADLLAITTAALGPNTPIRDPGMIASAAHRPRTTAFGEDA
FT                   YPDLHTKAAAILHSILRNHPLVDGNKRLAWVACRTFLAVNGADFTPDEDAAVDFVMRAA
FT                   ASELGDVEAIAAVLREWTG"
     atgaggtacc tgaccaccgc cgacctcctc gcgatcacca ccgccgccct cggcccgaac        60
     accccgatcc gcgaccccgg catgatcgcc tccgcagcgc accgcccccg caccaccgcc       120
     ttcggcgagg acgcctaccc cgacctccac accaaggcgg cagcgatcct ccactcaatc       180
     ctgcgcaacc accccctggt cgacggcaac aagcgcctcg catgggtcgc ctgccgcaca       240
     ttcctcgccg tgaacggcgc cgacttcacc cccgacgagg acgccgcagt cgacttcgtg       300
     atgagagcgg cggcgtcgga gttgggggat gtggaggcga tcgcggcggt gctgcgggag       360
     tggacgggct ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page