(data stored in ACNUC7421 zone)

EMBL: CP001700.PE568

CP001700.PE568       Location/Qualifiers
FT   CDS_pept        670631..672448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0586"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class I (M); KEGG: tfu:Tfu_0389 methionyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69523"
FT                   /db_xref="GOA:C7PYW7"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW7"
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /protein_id="ACU69523.1"
FT                   /translation="MPSTQRTILTAVAWPYANGPRHIGHVSGFGVPSDVFSRYQRMAGN
FT                   RVLMVSGTDEHGTPILVQADKEGVTARELADRYNRVIAEDLQSLGLAYDLFTRTTTRNH
FT                   YAVVQEIFKGLYDNGYIFPKTTMGAISPSTGRTLPDRYIEGTCPICGYDGARGDQCDNC
FT                   GNQLDPDRLIDPRSRINGETPKFIETEQFFLDLPAFASVLGGWLQQQKTWRPNVLKFSL
FT                   NLLDDLQPRAISRDLDWGVPVPLEGWVDRPDKKLYVWFDAVVGYLSASVEWARRTGDPD
FT                   AWRAFWQTGPNGEAPDAYYFMGKDNIVFHSEIWPAMLLGYDGRGEKNGKPGSLGALNLP
FT                   HEVVSSEFLTMEGRKFSSSRAVVIYVRDFLSRYDADALRYYITAAGPETQDTDFTWSEF
FT                   LRRNNDELVAGWGNLVNRAISMAAKNLGQIPAAKDLTAEDEALLATSRGAFAVVGDLLD
FT                   RCRFKAALAEAMRLVAEANKYVSDHEPWKLAKTDPERMATVLHVTLQVVDDAKTLLTPF
FT                   LPFSSEKVFHLLGGEGTWSAMPELREVEDLDGGPGYPVLTGDYEQALARWESTPIEAGR
FT                   PLAPPTPIFKKLDPSIVDEELARLGGEAA"
     atgccgtcca cccagcgcac catcctcacc gccgtggcgt ggccctacgc caacggtccc        60
     cgccacatcg ggcacgtctc cggcttcggc gtcccctccg atgtcttcag ccgctatcag       120
     cggatggcgg gcaaccgggt gctgatggtc agcgggaccg acgagcacgg gacgccgatc       180
     ctggtgcagg ccgacaagga gggcgtcacc gcccgggagt tggccgaccg gtacaaccgg       240
     gtcatcgctg aggacctgca gtcgctgggt ctggcctatg acctgttcac ccgcaccacg       300
     acgcgcaacc actacgcggt cgtgcaggag atcttcaagg gtctgtacga caacggctac       360
     atcttcccca agaccacgat gggcgccatc agcccctcga ccggccgtac gctgccggac       420
     cgctacatcg agggcacctg cccgatctgc ggctatgacg gcgcgcgcgg cgaccagtgc       480
     gacaactgcg gcaaccagct cgacccggac cggctgatcg acccgcgctc gcggatcaac       540
     ggcgagacgc cgaagttcat cgagaccgag cagttcttcc tggacctgcc ggccttcgcc       600
     tcggtgctcg gcggctggct gcagcagcag aagacctggc gtcccaacgt cctgaagttc       660
     tccctgaacc tgctggacga cctgcagccg cgcgccatct cccgcgacct ggactggggc       720
     gtcccggtcc cgctcgaggg ctgggtcgac cgccccgaca agaagctcta cgtctggttc       780
     gacgcggtcg tgggctacct gagcgcgagc gtggagtggg cccgccgcac cggcgacccg       840
     gacgcctggc gcgccttctg gcagaccggc ccgaacggcg aggcgcccga cgcctactac       900
     ttcatgggca aggacaacat cgtcttccac tccgagatct ggccggcgat gctgctgggc       960
     tacgacggcc ggggcgagaa gaacggcaag ccgggctccc tcggcgcgct gaacctcccg      1020
     cacgaggtgg tcagctcaga gttcctgacc atggagggcc gcaagttctc ctccagccgc      1080
     gccgtggtca tctacgtccg cgacttcctg tcccgctacg acgccgacgc cctgcgctac      1140
     tacatcaccg cggccggccc ggagacgcag gacacggact tcacctggtc ggagttcctg      1200
     cgccgcaaca acgacgagct ggtcgccggc tggggcaacc tggtcaaccg cgccatctcc      1260
     atggcggcga agaacctcgg acagatcccg gccgccaagg acctcaccgc cgaggacgag      1320
     gcgctgctgg cgacctcgcg cggcgccttc gccgtggtcg gcgacctgct ggaccgctgc      1380
     cgcttcaagg ccgcgctggc cgaggcgatg cgcctggtgg ccgaggccaa caagtacgtc      1440
     tcggaccacg agccgtggaa gctggccaag accgaccccg agcgcatggc caccgtcctg      1500
     cacgtcaccc tgcaggtcgt ggacgacgcc aagaccctgc tgaccccgtt cctgcccttc      1560
     tcctccgaga aggtcttcca cctgctcggc ggcgagggca cctggtcggc gatgccggag      1620
     ctgcgggagg tcgaggacct ggacggcggc ccggggtacc cggtgctcac cggcgactac      1680
     gagcaggcgc tggcccgctg ggagtcgacc ccgatcgagg ccggccgccc gctggcgccg      1740
     ccgacgccga tcttcaagaa gctggacccc tcgatcgtcg acgaggagct ggcgcggctc      1800
     ggcggcgagg cggcgtag                                                    1818
//

If you have problems or comments...

PBIL Back to PBIL home page