(data stored in ACNUC7421 zone)

EMBL: CP001700.PE569

CP001700.PE569       Location/Qualifiers
FT   CDS_pept        672453..673439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0587"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: sma:SAV_3589 deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69524"
FT                   /db_xref="GOA:C7PYW8"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW8"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ACU69524.1"
FT                   /translation="MADSETGLGGTEPGPADPAASEPGETKRKRKRKSRERDETPPPAP
FT                   EPLPAPVGDSHTHLDMQEPAAADIIAAADAVNVRRLVQVGVDVPSSRTAVELAAAFERV
FT                   HAAVALHPNEAPRLVLGDPDGWSGQHRAPGGAAALEEALAEIDKLAADEQVLGIGETGL
FT                   DYFRTGPEGAQAQQDSFRAHIAIAKRHGKALVIHDRDAHEDVLRILVEEGSPETVVFHC
FT                   YSGDAAMAKVCAERGYYMSFAGNLTYKANQALQEAFQVAPIDRVLVETDAPFLTPLPYR
FT                   GRPNAPYLVPYTVRAMAALRGMDSVTGLAELCQALDSNLRDAFQVRA"
     gtggcggaca gtgagacagg gctcggcggg accgagcccg gcccggcgga tccggccgca        60
     tcagagcccg gcgagaccaa gcgcaagcgg aagcgcaagt cccgggagcg ggacgagacc       120
     ccgcccccgg cgcccgagcc gctgccggct ccggtcggcg acagccacac gcacctggac       180
     atgcaggagc cggcggccgc ggacatcatc gcggccgcgg acgcggtgaa cgtgcgccgg       240
     ctggtccagg tcggcgtcga cgtcccgtcc tcgcgcaccg ccgtggagct ggccgccgcc       300
     ttcgagcgcg tccatgccgc cgtcgccctg cacccgaacg aggcgccgcg cctggtcctc       360
     ggcgaccccg acggctggtc cggccagcac cgcgcgcccg gcggcgcggc ggcgctggag       420
     gaggcgctcg ccgagatcga caagctggcc gcggacgagc aggtcctcgg tatcggcgag       480
     accggcctgg actacttccg caccggcccg gagggcgcgc aggcgcagca ggactccttc       540
     cgcgcccaca tcgccatcgc caagcggcat ggcaaagccc tggtgatcca cgaccgcgac       600
     gcacacgagg acgtcctgcg catcctggtc gaagagggtt cccccgaaac agtggtcttc       660
     cactgctatt cgggtgacgc cgcgatggcg aaggtgtgcg ccgagcgcgg ctactacatg       720
     tccttcgccg ggaacctcac ctacaaggcc aatcaggcat tgcaggaggc attccaggtg       780
     gcgccgatcg accgggtcct ggtcgagacc gacgcgccgt tcctgacgcc gctcccttat       840
     agaggacggc cgaacgcgcc ctacctggtt ccttatacgg tgcgcgccat ggcggcgctg       900
     cgaggcatgg acagtgtcac cggtttggcc gaactctgtc aggccctcga cagcaacctg       960
     cgggatgcct tccaggtgcg ggcataa                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page