(data stored in ACNUC7421 zone)

EMBL: CP001700.PE57

CP001700.PE57        Location/Qualifiers
FT   CDS_pept        complement(58453..59514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0057"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein"
FT                   /note="KEGG: sma:SAV_4365 molybdopterin-guanine
FT                   dinucleotide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69012"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH73"
FT                   /inference="similar to AA sequence:KEGG:SAV_4365"
FT                   /protein_id="ACU69012.1"
FT                   /translation="MDRLSGPGEPFDVIVLAGGGARRLGGTDKPALEIGGVSLLDRVLA
FT                   ACEGAASVAVVGPPRPVARQVVFTREFPPGGGPVPALAAGMTVGSAELVAVFAADMPLL
FT                   DEEAVTVLRRSLTADAVFFTDERGKDQPLAAIYRRNTLAAALDALPELRGARLFSVVEG
FT                   LDATRIPDTRGVTADCDTWEAVHAARALIATRPAAKAKMGDMDDKKLLADWCAAAAAEL
FT                   GLTGHELAESDLDAILGLAGVAAHNVLRPAAPLTTFLAGYAVGLRSSAGGGRGALDGPI
FT                   AKLSALAQAWDPAADGPAGTGHGGAASGTVGGSVAASPTAVRDATTGAAASAKSSSGTS
FT                   GDRAADAAGSGGQ"
     atggaccgtc tgagcggacc cggcgaaccc ttcgacgtga tcgtcctggc cggcggcggc        60
     gcgcgccggc tcggcgggac ggacaaaccc gccctcgaga tcggcggggt cagcctgctc       120
     gaccgggtgc tggcggcctg cgagggcgcc gcgtcggtgg cggtcgtggg cccgcccagg       180
     ccggtggcca ggcaggtcgt gttcacccgc gagttccctc ccggcggcgg tccggtaccg       240
     gctttggccg cggggatgac ggtcggctcg gccgagctgg tcgcggtctt cgccgccgac       300
     atgccgttgc tcgatgagga ggccgtcacg gttctgcggc gctcgctgac cgccgacgca       360
     gtgttcttca ccgacgagcg gggcaaggac caaccacttg ccgcgatata ccggcgtaac       420
     acgctcgcgg cagcattgga cgcgctaccc gaactccggg gcgcgcgcct gttctccgtc       480
     gtcgaagggc tggacgcgac ccggatcccg gacacgcggg gtgtgaccgc ggactgcgac       540
     acgtgggagg ccgttcacgc cgcccgcgcg ctgatcgcga cacgacccgc cgcgaaggcg       600
     aagatggggg atatggacga caagaagctg ctcgccgact ggtgcgccgc cgccgccgcc       660
     gaactcgggc tgaccgggca cgaactcgcc gagtccgatc tggacgcgat cctcggcctg       720
     gccggggtcg ccgcccacaa cgtgctgcga ccggcggcgc cgctgaccac gttcctggcc       780
     ggctacgcgg tcgggctgcg cagctcggcc ggcggcgggc gcggcgcgct cgacgggccg       840
     atcgcgaagc tcagtgccct ggctcaggcc tgggacccgg ctgccgacgg cccggccggt       900
     accggtcacg gcggcgcggc gagtgggacg gtcggcggct cggtggctgc cagcccgaca       960
     gccgtgcggg acgctactac cggcgctgcg gccagcgcca agagcagcag cggcaccagt      1020
     ggcgaccggg cggccgacgc agcgggatcc ggcggacagt ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page