(data stored in ACNUC7421 zone)

EMBL: CP001700.PE570

CP001700.PE570       Location/Qualifiers
FT   CDS_pept        673644..674771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0588"
FT                   /product="Transglycosylase domain protein"
FT                   /note="PFAM: Transglycosylase domain protein; protein of
FT                   unknown function DUF348; G5 domain protein; KEGG:
FT                   sma:SAV_3588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69525"
FT                   /db_xref="GOA:C7PYW9"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW9"
FT                   /inference="protein motif:PFAM:PF06737"
FT                   /protein_id="ACU69525.1"
FT                   /translation="MSSRRSASRHSEGSKVKVRAVQGTVLLGLVGAAGAYVGFEKTVHL
FT                   TVDGQERTIHTFDGKVADVLKAQGISTDGHDQVAPAPGESLADGEQISVRYGRQLDVSV
FT                   DGKDQKIWSTATTVDEALGDLGLHGSNPALSVNRDQAIGRQGLSFQIKTQRHVNVLVDG
FT                   RSIPLDTTAQTVAQALSQAHVTLAGQDTASPAPDTFPTNGETITVDRVTGTQETKQVPI
FT                   AFSTTEQSDPSAYVGSRTTVSSGTQGVQEVVYAYLTVNGVKQAPKIVSKTVTKQPVNAV
FT                   VKVGTKPVPTTVAGADNLNWAGVAQCESGGNPKSVGGGGLYFGLYQFSVSTWAAMGGSG
FT                   LPSNATPAEQTYRAKLLYVRSGAGQWPVCGRKLFT"
     gtgagcagta gacgttccgc tagtcggcac agcgagggtt ccaaggtcaa ggtccgcgcc        60
     gttcagggca cggtcctgct gggactcgtc ggcgccgccg gagcctacgt cggcttcgag       120
     aagaccgtcc atttgaccgt ggacggccag gaacgcacca tccacacgtt cgacggcaag       180
     gtcgccgacg tcctcaaggc ccagggcatc agcaccgacg gccacgacca ggtggcgccg       240
     gctcccggcg agagcttggc ggacggcgag cagatctcgg tgcgctacgg ccgccagctg       300
     gacgtgagcg tcgacggcaa ggaccagaag atctggtcca ccgccacgac cgtggacgag       360
     gcgctgggcg atctgggcct gcacggctcg aaccccgccc tgtcggtcaa ccgcgaccag       420
     gcgatcggcc gccagggact gagtttccag atcaagaccc agcggcacgt caacgtcctg       480
     gtcgacggcc gctcgatccc gctggacacc accgcgcaga ccgtggcgca ggcactgagc       540
     caggcccatg tgacgctggc cggccaggac accgcgagcc cggctccgga caccttcccg       600
     accaacggcg agaccatcac cgtggaccgg gtcaccggga cgcaggagac caagcaggtc       660
     ccgatcgcgt tctccacgac cgagcagtcc gacccgagcg cctacgtcgg atcgcggacc       720
     acggtctcct ccggcacgca gggcgtgcag gaagtcgtgt acgcgtacct gaccgtcaac       780
     ggcgtgaagc aggcgccgaa gatcgtcagc aagaccgtca ccaagcagcc ggtgaacgcg       840
     gtggtcaagg tcggcaccaa gccggtaccg accaccgtgg ccggcgcgga caacctgaac       900
     tgggccggtg tcgcccagtg cgagtccggc ggcaacccca agtcggtcgg cggcggcggg       960
     ctgtacttcg ggctctacca attctcggtg tcgacctggg ccgcgatggg cggttccggg      1020
     ctgccctcga acgccacgcc ggcggagcag acctaccgcg cgaagctgct gtacgtgcgc      1080
     tccggcgccg ggcagtggcc ggtctgcggg cggaagctgt tcacctga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page