(data stored in ACNUC7421 zone)

EMBL: CP001700.PE571

CP001700.PE571       Location/Qualifiers
FT   CDS_pept        674932..675852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0589"
FT                   /product="dimethyladenosine transferase"
FT                   /note="KEGG: sgr:SGR_4356 putative dimethyladenosine
FT                   transferase; TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; SMART:
FT                   ribosomal RNA adenine methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69526"
FT                   /db_xref="GOA:C7PYX0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYX0"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ACU69526.1"
FT                   /translation="MSETPHSPPPTPEPDRLPARLLGPAEVRRLAEKLGVSPTKKLGQN
FT                   FVIDPNTIRRIVRAGDVTAEDVVVEVGPGLGSLTLGLLDVARRVVAVEIDPVLAAALPD
FT                   TLAEFAPGIAAGQAEFELVRADALRIAELPGSPPTALVANLPYNVAVPVLLHMLERFPS
FT                   IERTLIMVQSEVADRLAAEPGGRVYGVPSVKARWYADVKRAGAIGRSVFWPAPNVDSGL
FT                   VRLDRRAVPPSTKAGRRDVFAAVDAAFAQRRKTLRSALSGWAGSPAAAETALTAAGINP
FT                   SARGETLTVEEFARLAEHRPQREAA"
     atgtccgaaa ccccgcactc cccgccaccg actcccgagc ccgaccggct gccggcccgc        60
     cttttgggcc ccgccgaggt ccgccggctc gccgagaagc tcggcgtctc gccgaccaag       120
     aagctcgggc agaacttcgt catcgacccg aacacgatcc ggcggatcgt gcgggccggc       180
     gacgtcaccg ccgaggacgt ggtggtcgag gtcggtccgg gcctgggctc gctgaccctc       240
     gggctgctgg acgtggcgcg ccgcgtcgtc gccgtcgaga tcgacccggt cctggccgcc       300
     gcgctgccgg acacgctggc cgagttcgcg ccgggcatcg ccgccgggca ggcggagttc       360
     gagctggtgc gcgccgacgc gctgcggatc gccgagctgc ccggttcgcc gccgaccgcg       420
     ctggtcgcga acctgcccta caacgtcgcg gtcccggtgc tgctgcacat gctggagcgc       480
     ttcccgagca tcgagcgcac gctgatcatg gtccagtccg aggtcgccga ccggctggcc       540
     gccgagcccg gcggccgggt ctacggcgtg ccgtcggtca aggcccgctg gtacgccgac       600
     gtcaagcggg ccggcgccat cggccgcagc gtcttctggc cggcgccgaa cgtcgactcc       660
     gggctggtgc gcctggaccg ccgcgccgtc ccgccgagca cgaaggccgg gcgccgcgac       720
     gtgttcgccg ccgtggacgc cgccttcgcc cagcgccgca agaccctgcg gtcggcgctg       780
     agcggctggg ccggctcgcc ggcggccgcc gagacggcgc tgaccgccgc cgggatcaac       840
     ccgagcgcgc gcggcgagac gctgaccgtc gaggagttcg cccggctggc cgagcaccgg       900
     ccgcagcggg aggcggcatg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page