(data stored in ACNUC7421 zone)

EMBL: CP001700.PE572

CP001700.PE572       Location/Qualifiers
FT   CDS_pept        675849..676799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0590"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritolkinase"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; GHMP kinase domain protein;
FT                   KEGG: mjl:Mjls_4641 4-diphosphocytidyl-2-C-methyl-D-
FT                   erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69527"
FT                   /db_xref="GOA:C7PYX1"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYX1"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ACU69527.1"
FT                   /translation="MSSAAYIPDEGPRPGETESVTVRVPAKVNLALSVGPLRSDGYHDL
FT                   ATVFHAVGLFDEVNAAAADTLAVTCEGEGQVEVPLDDTNLAWRAAELLARTVGRSPGVR
FT                   LHLTKGIPVAGGMAGGSADAAGALVACDALWGTGLSRDDLHVLAAQLGSDVPFALHGGT
FT                   AMGTGRGEQITPVLARGEFHWVFAFAHDGLSTPAVFHELDRLREAAGEEATAPGVEDEL
FT                   LRALRAGDSTLLGAALRNDLTRPATSLRPDLRATLQAGREAGALGTLLSGSGPTCAFLA
FT                   ADAVAAATVAAALEAAPSVRAVRRALGPAAGAHLL"
     atgagctccg cggcgtacat cccggacgag ggtccgcgcc ccggcgagac cgagtccgtg        60
     accgtccgcg tcccggcgaa ggtcaacctc gcgctctccg tcggcccgct gcgctccgac       120
     ggctaccacg acctggcgac cgtcttccac gccgtcgggc tgttcgacga ggtcaacgcc       180
     gccgccgccg acaccctcgc ggtgacctgc gagggcgagg gccaggtcga ggtgccgctg       240
     gacgacacca acctggcgtg gcgcgccgcc gagctgctgg cccggaccgt cggccgcagc       300
     cccggcgtgc ggctgcacct gaccaagggc atcccggtgg ccggcgggat ggcgggcggc       360
     tcggccgacg ccgccggcgc gctggtcgcc tgcgacgcgc tgtggggcac cgggctctcg       420
     cgcgacgacc tgcacgtcct tgccgcgcag ctgggcagcg acgtcccctt cgcgctccac       480
     ggcggcacag cgatgggcac cggacgcggc gagcagatca cgccggtgct ggcccggggc       540
     gagttccact gggtcttcgc cttcgctcat gacgggcttt ccactccggc ggtcttccac       600
     gagctggacc ggctgcgtga ggctgcgggg gaggaggcga cggctccggg agtggaggac       660
     gagctgctgc gggcgctgcg ggccggagac tcaacgctgc tgggtgcggc gctgcgcaac       720
     gacctcacgc ggcccgcgac ctcgttgcgt cccgatttgc gcgccacgct ccaagccggc       780
     cgcgaagccg gagcgctggg aaccctgctc tccggatccg gcccgacctg cgctttcctc       840
     gccgccgacg cggtcgccgc ggctacggtc gcggcggcgc tggaggcggc gccctcggtc       900
     cgtgcggtgc ggcgggcgtt gggtcccgct gcgggcgcgc acctgctgtg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page