(data stored in ACNUC7421 zone)

EMBL: CP001700.PE573

CP001700.PE573       Location/Qualifiers
FT   CDS_pept        676873..679386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0591"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; aminoglycoside phosphotransferase;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; KEGG: fal:FRAAL0578 putative serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69528"
FT                   /db_xref="GOA:C7PYX2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYX2"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACU69528.1"
FT                   /translation="MDALKPEDPSRVGPFTPLARIGAGGMGRVYLARSRGGRPVAVKVI
FT                   RAEYAEDERFRTRFRREVQAARTVDGMYTAPVLDAGPDDAEPWLATAYIPGPSLQRAVH
FT                   EHGPLPERTARVMGAGIAEALGAIHSAGLIHRDLKPSNVILGPDGPRVIDFGISASEGG
FT                   SSLTTTGIVVGSPRYSSPEQCRADPALGPASDVFALGGVMVYATTGVPPFGDGPDHVQL
FT                   YLVVHETPDLTGVPMGLRPIVSACLEKDPANRPTTDELLDTLLPPEEAGATNAVDWLPD
FT                   AVYRDLREYSAAPIVALAAGTTHERGEDSARTPAPGEATPTGAGFDGGGVTGIGSGVGT
FT                   TAAPSSAGSDGPSNPGRRRMLAGIAGAVVVAAGGGGAWYAATRDSGRKSATQSAGATFP
FT                   PSTGSQNPSTPAAPSTTPTPSTTPSTTPTPTPSHVLGPWQEDWSSKTDLGGASGGAVIS
FT                   GSKLVGVYTATSVSNPIPPQDLIAIDTVSGGSAFPARSIPAVDNVGGAGIAADDTHAYS
FT                   YGAGTVYAWNLSDGSAAWNAKSGLQTSTSTNNMPTTGILGMVGTLLMVGSGNYDPGFPP
FT                   CLAAFDVTLKKAVWTLKPEDMQIVASPPTGLVLNQTSIAVSIPKLGNLFYVMLCDENSL
FT                   RVLKAMDMATGKEVWHVFFEAYSDNGAGTVTPTVTGTEQHVYLTDMHSGSVHAYSAAGK
FT                   WMWTYPSAVGKTAPSSDRRFTGQVLESGDAVYAADANRVYALQVSTKAVGGTPVWKNPA
FT                   TFNGIANVPALVGDKIWVEVHTPTEKNPLAMIVVDTADGQVVHSYPMPEGPTASSAELT
FT                   VPDPSGQAAYVLTASGQVLGYRRNQ"
     atggatgcgc tgaagcccga agacccgtcc cgcgtcgggc cgttcacccc gctcgcgcgg        60
     atcggcgcgg gcggcatggg ccgggtctac ctggcccggt cgcgcggcgg ccggccggtg       120
     gcggtgaagg tcatccgcgc cgagtacgcc gaggacgagc gcttccgcac ccggttccgg       180
     cgcgaggtgc aggccgcgcg caccgtggac gggatgtaca cggcgccggt cctggacgcc       240
     ggtcccgacg acgccgagcc gtggctggcc accgcctaca tacccggtcc ctcccttcag       300
     cgcgccgtcc acgagcacgg tccgctgccc gagcgcacgg cgcgggtcat gggcgccggc       360
     atcgctgagg cgctgggcgc gatccacagc gccggcctga tccaccgcga cctgaagccc       420
     tcgaacgtca tcctcggccc ggacggcccg cgcgtcatcg acttcggcat cagcgccagc       480
     gagggcggca gctccctgac cacgaccggc atcgtcgtcg gctcgccgcg ctactccagc       540
     cccgagcagt gccgcgccga tccggcgctg ggaccggcct ccgacgtctt cgcgctcggc       600
     ggcgtcatgg tctacgccac caccggcgtc ccgcccttcg gcgacggtcc ggaccacgtc       660
     cagctctacc tcgtggtgca cgagaccccg gacctgaccg gggtgccgat ggggctgcgg       720
     ccgatcgtct cggcgtgcct ggagaaggac ccggccaacc ggccgaccac cgacgagctg       780
     ctggacaccc tgctgccgcc cgaagaggcc ggcgcgacca acgccgtgga ctggctgccc       840
     gacgctgtgt accgggacct gcgcgagtac tccgccgcgc cgatcgtggc gctggcggcg       900
     gggacgacgc acgagcgcgg cgaggactcc gcgcggacgc ccgccccggg cgaggcgacc       960
     cccaccggcg ccggcttcga cggcgggggc gtcacgggga tcggcagcgg tgtgggcacg      1020
     accgccgcgc cctcgtccgc cggctcggat ggaccctcga acccggggcg gcgccggatg      1080
     ctggctggga tcgcgggcgc cgtggtcgtg gccgcgggcg gcggcggtgc ctggtacgcc      1140
     gcgacgcgcg acagcggcag gaagtcggcg acgcagagcg ccggggcgac cttcccgccc      1200
     tcgacggggt cgcagaaccc ttccacgccc gcggcgccct cgacgacgcc cacgccctcg      1260
     accacgccct cgacgacgcc cacgccgacc ccctcgcacg tcctgggtcc gtggcaggag      1320
     gactggagct cgaagaccga cctgggcggc gcctcgggcg gcgcggtgat cagcggcagc      1380
     aagctggtcg gcgtctacac ggccacgagc gtgtccaacc cgatcccgcc gcaggacctg      1440
     atcgcgatcg acaccgtctc gggcggctcg gcgttccccg cgaggtcgat ccccgcggtc      1500
     gacaacgtcg ggggcgcggg gatcgccgcc gacgacacgc acgcgtacag ctacggcgcc      1560
     gggaccgtct acgcgtggaa cctcagcgac ggctcggcgg cgtggaacgc caagagcggc      1620
     ctgcagacct cgacgtccac caacaacatg cccacgaccg gcatcctcgg gatggtcggt      1680
     accctcctga tggtcggctc cggcaactac gaccccggat tcccgccctg cctggccgcg      1740
     ttcgacgtca cgctcaagaa ggcggtctgg acgttgaagc cggaggacat gcagatcgtg      1800
     gcctccccgc cgaccggact ggtcctgaac cagaccagca tcgccgtgtc gatccccaag      1860
     ctggggaacc tgttctacgt gatgctctgc gacgagaact cgctgcgggt gctcaaggcc      1920
     atggacatgg ccacgggcaa ggaggtctgg cacgtcttct tcgaggccta cagcgacaac      1980
     ggcgccggca ccgtcacccc gaccgtgacc ggcactgagc agcacgtcta cctcaccgac      2040
     atgcacagcg gctcggtcca cgcctacagc gccgccggca agtggatgtg gacctacccc      2100
     agcgccgtgg gcaagacggc gccctcctcc gaccgccgct tcaccggcca ggtcctggag      2160
     tccggcgacg ccgtctacgc cgccgacgcg aaccgcgtct acgccctcca ggtgagcacc      2220
     aaggcggtcg gcggaacccc ggtgtggaag aaccctgcga cgttcaacgg catcgccaac      2280
     gtccccgccc tcgtcggcga caagatctgg gtcgaggtcc acacccccac ggagaagaac      2340
     ccgctggcga tgatcgtggt ggacaccgcc gacggccagg tcgtgcactc ctacccgatg      2400
     cccgagggcc cgaccgccag cagcgccgag ctcacggtcc ccgacccctc cggccaggcg      2460
     gcgtacgtcc tgaccgccag cggccaggtg ctcggctacc ggcggaacca gtga            2514
//

If you have problems or comments...

PBIL Back to PBIL home page